DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX4 and RAB7A

DIOPT Version :10

Sequence 1:NP_733043.1 Gene:RabX4 / 42960 FlyBaseID:FBgn0051118 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_565521.1 Gene:RAB7A / 816724 AraportID:AT2G21880 Length:212 Species:Arabidopsis thaliana


Alignment Length:186 Identity:73/186 - (39%)
Similarity:112/186 - (60%) Gaps:7/186 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVLVLGDSNVGKTCIVHRYCDEKYYDTYISTIGIDFKQKLINLDGVPIKLQIWDTAGQERFRTLT 74
            ||:|||||.||||.::::|..:|:...|.:|||.||..|.:::|...:.||||||||||||::|.
plant    11 KVIVLGDSGVGKTSLMNQYVYKKFNKQYKATIGADFVTKELHIDEKSVTLQIWDTAGQERFQSLG 75

  Fly    75 TAYYRGAMGILLMYDVTNLESYNNLSYWLRNIQENASPDVVK----VLAGNKCEC-SATQRMVDK 134
            .|:||||...:|:|||.||:|:..|:.|.....:.|:|...:    ||.|||.:. ....|:|..
plant    76 AAFYRGADCCVLVYDVNNLKSFETLNNWHTEFLKQANPMEPETFPFVLIGNKTDVDGGNSRVVSN 140

  Fly   135 ERG-EKIAENFDMPFFEVSCKSNINIEDAFLSLAR-KIREQRERRGDNFDNDESKD 188
            :|. |......::|:.|.|.|.:.||::||||:|. .:..:|::..|.:...:..|
plant   141 KRAIEWCGSKGNIPYHETSAKEDTNIDEAFLSVAHIALSNERKQSNDIYPRGQYHD 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX4NP_733043.1 RAB 9..170 CDD:197555 70/166 (42%)
RAB7ANP_565521.1 Rab7 10..181 CDD:206655 70/169 (41%)

Return to query results.
Submit another query.