DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX4 and rab12

DIOPT Version :9

Sequence 1:NP_733043.1 Gene:RabX4 / 42960 FlyBaseID:FBgn0051118 Length:213 Species:Drosophila melanogaster
Sequence 2:XP_002937521.2 Gene:rab12 / 779581 XenbaseID:XB-GENE-492791 Length:248 Species:Xenopus tropicalis


Alignment Length:162 Identity:70/162 - (43%)
Similarity:107/162 - (66%) Gaps:2/162 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVLVLGDSNVGKTCIVHRYCDEKYYDTYISTIGIDFKQKLINLDGVPIKLQIWDTAGQERFRTLT 74
            :|:::|...||||.::.|:.|:.:.:...||:|:|||.|.:.|.|..|:||||||||||||.::|
 Frog    48 QVIIIGSRGVGKTSLMERFTDDTFCEACKSTVGVDFKIKTVELRGKKIRLQIWDTAGQERFNSIT 112

  Fly    75 TAYYRGAMGILLMYDVTNLESYNNLSYWLRNIQENASPDVVKVLAGNKCECSATQRMVDKERGEK 139
            :||||.|.||:|:||:|..|::.:|..|::.|.:.||.:...:|.|||.:|. |.|.:.:::|||
 Frog   113 SAYYRSAKGIILVYDITKKETFEDLPKWMKMIDKYASEEAELLLVGNKLDCE-TDREITRQQGEK 176

  Fly   140 IAENF-DMPFFEVSCKSNINIEDAFLSLARKI 170
            .|:.. .|.|.|.|.|.|.|:::.||.|...|
 Frog   177 FAQQITGMRFCEASAKDNFNVDEIFLKLVDDI 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX4NP_733043.1 RAB 9..170 CDD:197555 69/160 (43%)
rab12XP_002937521.2 P-loop_NTPase 47..248 CDD:393306 70/162 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.