Sequence 1: | NP_733043.1 | Gene: | RabX4 / 42960 | FlyBaseID: | FBgn0051118 | Length: | 213 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_937806.1 | Gene: | Rab35 / 77407 | MGIID: | 1924657 | Length: | 201 | Species: | Mus musculus |
Alignment Length: | 200 | Identity: | 78/200 - (39%) |
---|---|---|---|
Similarity: | 125/200 - (62%) | Gaps: | 12/200 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MALDFVATYKVLVLGDSNVGKTCIVHRYCDEKYYDTYISTIGIDFKQKLINLDGVPIKLQIWDTA 65
Fly 66 GQERFRTLTTAYYRGAMGILLMYDVTNLESYNNLSYWLRNIQENASPDVVKVLAGNKCECSATQR 130
Fly 131 MVDKERGEKIAENFDMPFFEVSCKSNINIEDAFLSLARKI---------REQRERRGDNFD-NDE 185
Fly 186 SKDKK 190 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RabX4 | NP_733043.1 | RAB | 9..170 | CDD:197555 | 69/160 (43%) |
Rab35 | NP_937806.1 | Rab35 | 3..201 | CDD:133310 | 75/197 (38%) |
Effector region. /evidence=ECO:0000250 | 37..45 | 5/7 (71%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |