DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX4 and Rab3c

DIOPT Version :9

Sequence 1:NP_733043.1 Gene:RabX4 / 42960 FlyBaseID:FBgn0051118 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_076341.1 Gene:Rab3c / 67295 MGIID:1914545 Length:227 Species:Mus musculus


Alignment Length:160 Identity:77/160 - (48%)
Similarity:110/160 - (68%) Gaps:1/160 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DFVATYKVLVLGDSNVGKTCIVHRYCDEKYYDTYISTIGIDFKQKLINLDGVPIKLQIWDTAGQE 68
            :|...:|:|::|:|:||||..:.||.|:.:...::||:|||||.|.:..:...||||||||||||
Mouse    26 NFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFKNEKRIKLQIWDTAGQE 90

  Fly    69 RFRTLTTAYYRGAMGILLMYDVTNLESYNNLSYWLRNIQENASPDVVKVLAGNKCECSATQRMVD 133
            |:||:||||||||||.:||||:||.||:|.:..|...|:..:..:...:||||||:.. .:|:|.
Mouse    91 RYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVILAGNKCDME-DERVVS 154

  Fly   134 KERGEKIAENFDMPFFEVSCKSNINIEDAF 163
            .|||:::.|.....|||.|.|.|||::..|
Mouse   155 TERGQRLGEQLGFEFFETSAKDNINVKQTF 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX4NP_733043.1 RAB 9..170 CDD:197555 76/155 (49%)
Rab3cNP_076341.1 Rab3 30..194 CDD:206657 76/156 (49%)
Effector region. /evidence=ECO:0000250 59..67 4/7 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 202..227
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.