DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX4 and RAB17

DIOPT Version :10

Sequence 1:NP_733043.1 Gene:RabX4 / 42960 FlyBaseID:FBgn0051118 Length:213 Species:Drosophila melanogaster
Sequence 2:XP_016860182.1 Gene:RAB17 / 64284 HGNCID:16523 Length:338 Species:Homo sapiens


Alignment Length:119 Identity:42/119 - (35%)
Similarity:77/119 - (64%) Gaps:2/119 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YKVLVLGDSNVGKTCIVHRYCDEKYYDTYISTIGIDFKQKLINLDGVPIKLQIWDTAGQERFRTL 73
            :|:::||..:|||:.:..||. :..:.:.:.|:|..|..|::::....:||:||||||||::.::
Human    20 FKLVLLGSGSVGKSSLALRYV-KNDFKSILPTVGCAFFTKVVDVGATSLKLEIWDTAGQEKYHSV 83

  Fly    74 TTAYYRGAMGILLMYDVTNLESYNNLSYWLRNIQENASP-DVVKVLAGNKCECS 126
            ...|:|||...||:||:|..:|:.....||::::|...| :|:.:|.|||.:.|
Human    84 CHLYFRGANAALLVYDITRKDSFLKAQQWLKDLEEELHPGEVLVMLVGNKTDLS 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX4NP_733043.1 RAB 9..170 CDD:197555 42/119 (35%)
RAB17XP_016860182.1 P-loop containing Nucleoside Triphosphate Hydrolases 20..>146 CDD:476819 42/119 (35%)

Return to query results.
Submit another query.