DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX4 and Rab37

DIOPT Version :10

Sequence 1:NP_733043.1 Gene:RabX4 / 42960 FlyBaseID:FBgn0051118 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_067386.3 Gene:Rab37 / 58222 MGIID:1929945 Length:223 Species:Mus musculus


Alignment Length:190 Identity:88/190 - (46%)
Similarity:133/190 - (70%) Gaps:7/190 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TYKVLVLGDSNVGKTCIVHRYCDEKYYD-TYISTIGIDFKQKLINLDGVPIKLQIWDTAGQERFR 71
            |.||::||||.|||||.:.::.|..:.. |:|:|:||||:.|::.:||..:||||||||||||||
Mouse    29 TGKVMLLGDSGVGKTCFLIQFKDGAFLSGTFIATVGIDFRNKVVTVDGARVKLQIWDTAGQERFR 93

  Fly    72 TLTTAYYRGAMGILLMYDVTNLESYNNLSYWLRNIQENASPDVVKVLAGNKCECSATQRMVDKER 136
            ::|.||||.|..:||:||:||..|::|:..||..|.|.|..|||.:|.|||.:.| ::|::..|.
Mouse    94 SVTHAYYRDAQALLLLYDITNQSSFDNIRAWLTEIHEYAQRDVVIMLLGNKADVS-SERVIRSED 157

  Fly   137 GEKIAENFDMPFFEVSCKSNINIEDAFLSLARKIREQRERRGD--NF---DNDESKDKKS 191
            ||.:|..:.:||.|.|.|:.:|:|.|||::|::::.:..|:.|  :|   |..||:.|:|
Mouse   158 GETLAREYGVPFMETSAKTGMNVELAFLAIAKELKYRAGRQPDEPSFQIRDYVESQKKRS 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX4NP_733043.1 RAB 9..170 CDD:197555 79/161 (49%)
Rab37NP_067386.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
Rab26 31..220 CDD:206695 87/188 (46%)
Switch 1. /evidence=ECO:0000250|UniProtKB:P62820 52..67 5/14 (36%)
Switch 2. /evidence=ECO:0000250|UniProtKB:P62820 85..102 13/16 (81%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.