DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX4 and zgc:162879

DIOPT Version :9

Sequence 1:NP_733043.1 Gene:RabX4 / 42960 FlyBaseID:FBgn0051118 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001082896.1 Gene:zgc:162879 / 572256 ZFINID:ZDB-GENE-070424-92 Length:663 Species:Danio rerio


Alignment Length:182 Identity:64/182 - (35%)
Similarity:108/182 - (59%) Gaps:5/182 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DFVATYKVLVLGDSNVGKTCIVHRYCDEKYYDTYISTIGIDFKQKLINLDGVPIKLQIWDTAGQE 68
            |....|::::.||:..||:..:.|....::.....:|:|:||:.|.:.:||....||||||||||
Zfish   463 DLAPVYRLVLAGDAGSGKSSFLLRLSLNEFRGDIQTTLGVDFQIKKMLVDGEKTNLQIWDTAGQE 527

  Fly    69 RFRTLTTAYYRGAMGILLMYDVTNLESYNNLSYWLRNIQENASPDVVKVLAGNKCECSATQ---R 130
            |||::..:|:|.|.|:||:||||:..|:.|:..|:..|:|:...|:...:.|||.:..|.:   .
Zfish   528 RFRSIARSYFRKAHGVLLLYDVTSESSFLNVREWVEQIRESTDEDIPMCIIGNKVDLRAARPEGS 592

  Fly   131 MVDKERGEKIAENFDMPFFEVSCKSNINIEDAFLSLARKIREQRE--RRGDN 180
            .|....|||:|.|::..|.|.|.|...::.:|.|.|||::::..:  ||.::
Zfish   593 CVSSIHGEKLAMNYNALFCEASAKEGTSVIEAVLHLAREVKKHVKLGRRSES 644

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX4NP_733043.1 RAB 9..170 CDD:197555 61/163 (37%)
zgc:162879NP_001082896.1 EFh 5..60 CDD:238008
EF-hand_7 6..60 CDD:290234
TMPIT 104..>187 CDD:285135
RILP-like <180..290 CDD:304877
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 324..343
RAB 468..634 CDD:197555 61/165 (37%)
Rab 468..630 CDD:206640 59/161 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.