Sequence 1: | NP_733043.1 | Gene: | RabX4 / 42960 | FlyBaseID: | FBgn0051118 | Length: | 213 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_699335.4 | Gene: | rasef / 570731 | ZFINID: | ZDB-GENE-081105-157 | Length: | 706 | Species: | Danio rerio |
Alignment Length: | 206 | Identity: | 72/206 - (34%) |
---|---|---|---|
Similarity: | 114/206 - (55%) | Gaps: | 24/206 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 YKVLVLGDSNVGKTCIVHRYCDEKYYDTYISTIGIDFKQKLINLDGVPIKLQIWDTAGQERFRTL 73
Fly 74 TTAYYRGAMGILLMYDVTNLESYNNLSYWLRNIQENASPDVVKVLAGNKCEC--SATQ---RMVD 133
Fly 134 KERGEKIAENFDMPFFEVSCKSNINIEDAFLSLARKIREQRERRGDNFDNDESKDKKSPGSNGLG 198
Fly 199 TFSLGSLSGEN 209 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RabX4 | NP_733043.1 | RAB | 9..170 | CDD:197555 | 65/165 (39%) |
rasef | XP_699335.4 | EFh | 9..69 | CDD:238008 | |
EF-hand_7 | 10..68 | CDD:290234 | |||
DUF904 | 201..>253 | CDD:283624 | |||
RAB | 508..674 | CDD:197555 | 65/165 (39%) | ||
Rab | 508..672 | CDD:206640 | 63/163 (39%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0078 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |