DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX4 and rasef

DIOPT Version :9

Sequence 1:NP_733043.1 Gene:RabX4 / 42960 FlyBaseID:FBgn0051118 Length:213 Species:Drosophila melanogaster
Sequence 2:XP_699335.4 Gene:rasef / 570731 ZFINID:ZDB-GENE-081105-157 Length:706 Species:Danio rerio


Alignment Length:206 Identity:72/206 - (34%)
Similarity:114/206 - (55%) Gaps:24/206 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YKVLVLGDSNVGKTCIVHRYCDEKYYDTYISTIGIDFKQKLINLDGVPIKLQIWDTAGQERFRTL 73
            |::::.||:.|||:..:.|.|..::.....:|:|:||:.|.:.:||||..||:||||||||||::
Zfish   508 YRIVLAGDAAVGKSSFLLRLCKNEFKGNTSATLGVDFQMKTLVVDGVPTVLQLWDTAGQERFRSI 572

  Fly    74 TTAYYRGAMGILLMYDVTNLESYNNLSYWLRNIQENASPDVVKVLAGNKCEC--SATQ---RMVD 133
            ..:|:|.|.|:||:||||..:|:.|:..|:..|::.:..|:..:|.|||.:.  .|.|   ..:.
Zfish   573 AKSYFRRADGVLLLYDVTCEKSFLNVREWVDIIEDVSQDDIPIMLVGNKTDLRKEALQDGVTCIP 637

  Fly   134 KERGEKIAENFDMPFFEVSCKSNINIEDAFLSLARKIREQRERRGDNFDNDESKDKKSPGSNGLG 198
            ...|||:|..:...|.|.|.|...||.:|.|.|||::.:..:            |.|.|      
Zfish   638 TSYGEKLAMTYSALFCETSAKDGSNIIEAVLHLAREVTKHAD------------DYKEP------ 684

  Fly   199 TFSLGSLSGEN 209
             .|:..|||.:
Zfish   685 -VSVAKLSGNH 694

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX4NP_733043.1 RAB 9..170 CDD:197555 65/165 (39%)
rasefXP_699335.4 EFh 9..69 CDD:238008
EF-hand_7 10..68 CDD:290234
DUF904 201..>253 CDD:283624
RAB 508..674 CDD:197555 65/165 (39%)
Rab 508..672 CDD:206640 63/163 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.