DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX4 and rab44

DIOPT Version :9

Sequence 1:NP_733043.1 Gene:RabX4 / 42960 FlyBaseID:FBgn0051118 Length:213 Species:Drosophila melanogaster
Sequence 2:XP_689291.6 Gene:rab44 / 560799 ZFINID:ZDB-GENE-040724-117 Length:2402 Species:Danio rerio


Alignment Length:187 Identity:64/187 - (34%)
Similarity:112/187 - (59%) Gaps:3/187 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VATYKVLVLGDSNVGKTCIVHRYCDEKYYDTYISTIGIDFKQKLINLDGVPIKLQIWDTAGQERF 70
            |..:.|:::|:|.||||..:.|:.:.::.:.|.||||:|...:.:.|....:|||||||||||||
Zfish  2215 VVQFNVVMVGNSCVGKTSFIRRFHEGQFTEDYRSTIGVDTFVQTVELPDRTVKLQIWDTAGQERF 2279

  Fly    71 RTLTTAYYRGAMGILLMYDVTNLESYNNLSYWLRNIQENASPDVVKVLAGNKCECSATQRMVDKE 135
            .::||..:..|.|:||||::|..:|:.::..|:...:|.|..|||.:|.|||.:  :..|.|..:
Zfish  2280 HSITTQVFHKAEGLLLMYEITCSKSFISIRDWISQARERAQDDVVMMLLGNKND--SVNREVQIQ 2342

  Fly   136 RGEKIAENFDMPFFEVSCKSNINIEDAFLSLARKIREQRERRGDNFD-NDESKDKKS 191
            .|..:|..:::.|.|.|..:..|:.::..:||..:.:::.:|.::.. ..|.:.|||
Zfish  2343 EGADLAREYNIHFMECSAANGANVSESMRTLAELLVQRKRKREEHTTLRREPQQKKS 2399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX4NP_733043.1 RAB 9..170 CDD:197555 58/160 (36%)
rab44XP_689291.6 EIN3 <1419..>1534 CDD:296674
RAB 2218..2380 CDD:197555 58/163 (36%)
Rab 2218..2375 CDD:206640 57/158 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.