DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX4 and LOC555645

DIOPT Version :9

Sequence 1:NP_733043.1 Gene:RabX4 / 42960 FlyBaseID:FBgn0051118 Length:213 Species:Drosophila melanogaster
Sequence 2:XP_009295987.1 Gene:LOC555645 / 555645 -ID:- Length:280 Species:Danio rerio


Alignment Length:219 Identity:80/219 - (36%)
Similarity:126/219 - (57%) Gaps:23/219 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DFVATYKVLVLGDSNVGKTCIVHRYCDEKYYDTYISTIGIDFKQKLINLDGVPIKLQIWDTAGQE 68
            ||:  :|::::|||||||||::..:...:..:...:|||:||..:.:::||..:|:|:|||||||
Zfish    76 DFL--FKIILIGDSNVGKTCVIQSFRSAEVTELQHNTIGVDFTVRSMDVDGRRVKMQVWDTAGQE 138

  Fly    69 RFRTLTTAYYRGAMGILLMYDVTNLESYNNLSYWLRNIQENASPDVVKVLAGNKCECSATQRMVD 133
            ||||:|.:|||.|.|.::.||::..:::::|.:|::.:::..:..:|.||.||||:..| ||.|.
Zfish   139 RFRTITQSYYRSAHGAMIAYDLSRRDTFDSLPHWIQALEQYGAASLVLVLIGNKCDLEA-QRQVL 202

  Fly   134 KERGEKIAENFD-MPFFEVSCKSNINIEDAFLSLARKIREQRERRGDNFDNDESKDKKSPGSNGL 197
            .|....:||... :...|.|.|.:.|||:||..:|   ||...|.|.....|...|  ||     
Zfish   203 FEDACTLAERSGALAALETSAKHHHNIEEAFQLMA---RELLVRHGGIHYQDNQSD--SP----- 257

  Fly   198 GTFSLGS----LSGE----NRCTC 213
             |..|.|    :.||    ..|.|
Zfish   258 -TVYLHSDSHPIEGEQLEKRSCDC 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX4NP_733043.1 RAB 9..170 CDD:197555 63/161 (39%)
LOC555645XP_009295987.1 P-loop_NTPase 76..240 CDD:304359 66/169 (39%)
RAB 79..241 CDD:197555 65/165 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.