DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX4 and rab12

DIOPT Version :9

Sequence 1:NP_733043.1 Gene:RabX4 / 42960 FlyBaseID:FBgn0051118 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001018466.1 Gene:rab12 / 553657 ZFINID:ZDB-GENE-050522-555 Length:235 Species:Danio rerio


Alignment Length:167 Identity:72/167 - (43%)
Similarity:108/167 - (64%) Gaps:4/167 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ATYK--VLVLGDSNVGKTCIVHRYCDEKYYDTYISTIGIDFKQKLINLDGVPIKLQIWDTAGQER 69
            |.||  |:::|...||||.::.|:.|:.:.:...||:|:|||.|.:.|.|..|:|||||||||||
Zfish    32 ADYKLQVIIIGSRGVGKTSLMERFTDDTFCEACKSTVGVDFKIKTVELRGKKIRLQIWDTAGQER 96

  Fly    70 FRTLTTAYYRGAMGILLMYDVTNLESYNNLSYWLRNIQENASPDVVKVLAGNKCECSATQRMVDK 134
            |.::|:||||||.||:|:||:|..|::.:|..|::.|.:.||.|...:|.|||.:|. :.|.:.:
Zfish    97 FNSITSAYYRGAKGIVLVYDITKQETFEDLPKWMKMIDKYASEDAELLLVGNKLDCE-SDRAISR 160

  Fly   135 ERGEKIAENFD-MPFFEVSCKSNINIEDAFLSLARKI 170
            ::.|:.|.... |.|.|.|.|.|.|:::.||.|...|
Zfish   161 QQAERFASRISGMRFCEASAKDNFNVDEIFLKLVDDI 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX4NP_733043.1 RAB 9..170 CDD:197555 70/163 (43%)
rab12NP_001018466.1 Rab12 36..235 CDD:206699 69/163 (42%)
RAB 36..200 CDD:197555 69/163 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
43.780

Return to query results.
Submit another query.