Sequence 1: | NP_733043.1 | Gene: | RabX4 / 42960 | FlyBaseID: | FBgn0051118 | Length: | 213 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_057614.1 | Gene: | RAB8B / 51762 | HGNCID: | 30273 | Length: | 207 | Species: | Homo sapiens |
Alignment Length: | 196 | Identity: | 101/196 - (51%) |
---|---|---|---|
Similarity: | 142/196 - (72%) | Gaps: | 9/196 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MALDFVATYKVLVLGDSNVGKTCIVHRYCDEKYYDTYISTIGIDFKQKLINLDGVPIKLQIWDTA 65
Fly 66 GQERFRTLTTAYYRGAMGILLMYDVTNLESYNNLSYWLRNIQENASPDVVKVLAGNKCECSATQR 130
Fly 131 MVDKERGEKIAENFDMPFFEVSCKSNINIEDAFLSLARKIREQRERRGDNFDNDESKDKKSPGSN 195
Fly 196 G 196 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RabX4 | NP_733043.1 | RAB | 9..170 | CDD:197555 | 93/160 (58%) |
RAB8B | NP_057614.1 | Rab8_Rab10_Rab13_like | 6..172 | CDD:206659 | 94/166 (57%) |
Effector region. /evidence=ECO:0000250 | 37..45 | 6/7 (86%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0078 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |