DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX4 and Rab10

DIOPT Version :10

Sequence 1:NP_733043.1 Gene:RabX4 / 42960 FlyBaseID:FBgn0051118 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_059055.2 Gene:Rab10 / 50993 RGDID:620879 Length:200 Species:Rattus norvegicus


Alignment Length:204 Identity:102/204 - (50%)
Similarity:140/204 - (68%) Gaps:15/204 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YKVLVLGDSNVGKTCIVHRYCDEKYYDTYISTIGIDFKQKLINLDGVPIKLQIWDTAGQERFRTL 73
            :|:|::|||.|||||::.|:.|:.:..|:|||||||||.|.:.|.|..||||||||||||||.|:
  Rat    10 FKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQERFHTI 74

  Fly    74 TTAYYRGAMGILLMYDVTNLESYNNLSYWLRNIQENASPDVVKVLAGNKCECSATQRMVDKERGE 138
            ||:||||||||:|:||:||.:|:.|:|.|||||.|:|:.||.::|.||||:.. .:|:|.|.:||
  Rat    75 TTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMD-DKRVVPKGKGE 138

  Fly   139 KIAENFDMPFFEVSCKSNINIEDAFLSLARKIREQRERRGDNFDNDESKDKKSPGSNGLGTFSLG 203
            :||....:.|||.|.|:|||||.|||:||..|..:             ...|.|.|..:...|.|
  Rat   139 QIAREHGIRFFETSAKANINIEKAFLTLAEDILRK-------------TPVKEPNSENVDISSGG 190

  Fly   204 SLSG-ENRC 211
            .::| :::|
  Rat   191 GVTGWKSKC 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX4NP_733043.1 RAB 9..170 CDD:197555 94/160 (59%)
Rab10NP_059055.2 Rab8_Rab10_Rab13_like 7..173 CDD:206659 95/163 (58%)

Return to query results.
Submit another query.