DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX4 and rab40b

DIOPT Version :9

Sequence 1:NP_733043.1 Gene:RabX4 / 42960 FlyBaseID:FBgn0051118 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001002524.2 Gene:rab40b / 436797 ZFINID:ZDB-GENE-040718-257 Length:287 Species:Danio rerio


Alignment Length:177 Identity:74/177 - (41%)
Similarity:104/177 - (58%) Gaps:6/177 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ALDFVATYKVLVLGDSNVGKTCIVHRYCDEKYYDTYISTIGIDFKQKLINLDGVPIKLQIWDTAG 66
            |.||:  .|.|::|||:|||..|:....|......|...:|||:|...|.|||..:|||:|||:|
Zfish    18 AYDFL--LKFLLVGDSDVGKGEILASLQDGSSESPYGYNMGIDYKTTTILLDGRRVKLQLWDTSG 80

  Fly    67 QERFRTLTTAYYRGAMGILLMYDVTNLESYNNLSYWLRNIQENASPDVVKVLAGNKCECSATQRM 131
            |.||.|:..:|.|||.|::|:||:||..|::.:..|::.|.|:| |.|.|:|.||:... |.:|.
Zfish    81 QGRFCTIFRSYSRGAQGVILVYDITNRWSFDGIDRWIKEIDEHA-PGVPKILVGNRLHL-AYKRQ 143

  Fly   132 VDKERGEKIAENFDMPFFEVSCKSNINIEDAFLSLARKI--REQRER 176
            |..|..:...|...:.|||||...|.||.::|..|||.:  |...||
Zfish   144 VTTEHTQAFVERLGVTFFEVSPLCNFNITESFTELARIVLMRHGMER 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX4NP_733043.1 RAB 9..170 CDD:197555 68/160 (43%)
rab40bNP_001002524.2 Rab40 17..194 CDD:133321 74/177 (42%)
RAB 23..185 CDD:197555 68/163 (42%)
SOCS_Rab40 195..237 CDD:239711
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.