DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX4 and Rab7

DIOPT Version :9

Sequence 1:NP_733043.1 Gene:RabX4 / 42960 FlyBaseID:FBgn0051118 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster


Alignment Length:168 Identity:66/168 - (39%)
Similarity:102/168 - (60%) Gaps:7/168 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVLVLGDSNVGKTCIVHRYCDEKYYDTYISTIGIDFKQKLINLDGVPIKLQIWDTAGQERFRTLT 74
            ||::||||:||||.::::|.::::.:.|.:|||.||..|.:.::...:.:|||||||||||::|.
  Fly    10 KVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQSLG 74

  Fly    75 TAYYRGAMGILLMYDVTNLESYNNLSYWLRNIQENASP----DVVKVLAGNKCECSATQRMVDKE 135
            .|:||||...:|:||||...|:.||..|.......|||    ....|:.|||.:..  .|.|...
  Fly    75 VAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLD--NRQVSTR 137

  Fly   136 RGEKIAEN-FDMPFFEVSCKSNINIEDAFLSLARKIRE 172
            |.::..:: .|:|::|.|.|..||:|.||..:|:...|
  Fly   138 RAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALE 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX4NP_733043.1 RAB 9..170 CDD:197555 65/164 (40%)
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 66/168 (39%)
RAB 9..174 CDD:197555 65/165 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.