DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX4 and RAB8A

DIOPT Version :9

Sequence 1:NP_733043.1 Gene:RabX4 / 42960 FlyBaseID:FBgn0051118 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_005361.2 Gene:RAB8A / 4218 HGNCID:7007 Length:207 Species:Homo sapiens


Alignment Length:199 Identity:103/199 - (51%)
Similarity:145/199 - (72%) Gaps:14/199 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALDFVATYKVLVLGDSNVGKTCIVHRYCDEKYYDTYISTIGIDFKQKLINLDGVPIKLQIWDTA 65
            ||..:...:|:|::|||.|||||::.|:.::.:..|:|||||||||.:.|.|||..|||||||||
Human     1 MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTA 65

  Fly    66 GQERFRTLTTAYYRGAMGILLMYDVTNLESYNNLSYWLRNIQENASPDVVKVLAGNKCECSATQR 130
            |||||||:|||||||||||:|:||:||.:|::|:..|:|||:|:||.||.|::.||||:.: .:|
Human    66 GQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVN-DKR 129

  Fly   131 MVDKERGEKIAENFDMPFFEVSCKSNINIEDAFLSLARKIREQRERRGDNFDNDESKDKKSPGSN 195
            .|.||||||:|.::.:.|.|.|.|:|||:|:||.:|||.|:.:             .|||..|::
Human   130 QVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAK-------------MDKKLEGNS 181

  Fly   196 GLGT 199
            ..|:
Human   182 PQGS 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX4NP_733043.1 RAB 9..170 CDD:197555 95/160 (59%)
RAB8ANP_005361.2 Rab8_Rab10_Rab13_like 6..172 CDD:206659 96/166 (58%)
Effector region. /evidence=ECO:0000250 37..45 6/7 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.