DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX4 and rab1bb

DIOPT Version :9

Sequence 1:NP_733043.1 Gene:RabX4 / 42960 FlyBaseID:FBgn0051118 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001002129.2 Gene:rab1bb / 415219 ZFINID:ZDB-GENE-040625-133 Length:201 Species:Danio rerio


Alignment Length:188 Identity:89/188 - (47%)
Similarity:132/188 - (70%) Gaps:17/188 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YKVLVLGDSNVGKTCIVHRYCDEKYYDTYISTIGIDFKQKLINLDGVPIKLQIWDTAGQERFRTL 73
            :|:|::|||.|||:||:.|:.|:.|.:::|||||:|||.:.|.|||..||||||||||||||||:
Zfish     9 FKLLLIGDSGVGKSCILLRFADDTYTESFISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTI 73

  Fly    74 TTAYYRGAMGILLMYDVTNLESYNNLSYWLRNIQENASPDVVKVLAGNKCECSATQRMVDKERGE 138
            |::|||||.||:::||||:.|||||:..||:.|...||.:|.|:|.||||:.: |:::||....:
Zfish    74 TSSYYRGAHGIIVVYDVTDQESYNNVKQWLKEIDRYASENVNKLLVGNKCDLT-TKKVVDYTTAK 137

  Fly   139 KIAENFDMPFFEVSCKSNINIEDAFLSLARKIREQRERRGDNFDNDESKDKKSPGSNG 196
            :.|::..:||.|.|.|:..|:|.||:::|                :|.|.:..||::|
Zfish   138 EFADSLGIPFLETSAKNATNVEQAFMTMA----------------EEIKKRMRPGASG 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX4NP_733043.1 RAB 9..170 CDD:197555 84/160 (53%)
rab1bbNP_001002129.2 Rab1_Ypt1 7..172 CDD:206661 86/179 (48%)
RAB 9..172 CDD:197555 86/179 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.