DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX4 and Rab19

DIOPT Version :9

Sequence 1:NP_733043.1 Gene:RabX4 / 42960 FlyBaseID:FBgn0051118 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001261575.1 Gene:Rab19 / 38930 FlyBaseID:FBgn0015793 Length:219 Species:Drosophila melanogaster


Alignment Length:183 Identity:78/183 - (42%)
Similarity:116/183 - (63%) Gaps:11/183 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAL------DFVATYKVLVLGDSNVGKTCIVHRYCDEKYYDTYISTIGIDFKQKLINLDGVPIKL 59
            |||      ||:  :|::::||...||||||.|:....|.:.:.:|||:||..|.|.::|..|||
  Fly    10 MALPNEEHFDFL--FKIVLIGDCGTGKTCIVDRFKTGNYIERHGNTIGVDFSMKTIAVEGKQIKL 72

  Fly    60 QIWDTAGQERFRTLTTAYYRGAMGILLMYDVTNLESYNNLSYWLRNIQENASPDVVKVLAGNKCE 124
            |||||||||||||:|.:|||.|.|:|::||:|...|::||..|:..::...:.:|:.:|.||||:
  Fly    73 QIWDTAGQERFRTITQSYYRSANGVLIVYDITKRSSFSNLQKWIEEVRRYTASNVLIILVGNKCD 137

  Fly   125 CSATQRMVDKERGEKIAENFDMPFF--EVSCKSNINIEDAFLSLARKIREQRE 175
            .. .||.||.|...::.:......|  |.|.|.|:|:||||..||.:::.|.:
  Fly   138 LE-EQREVDFEEARQMCQYIPEILFVMETSAKENMNVEDAFRCLANELKRQHD 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX4NP_733043.1 RAB 9..170 CDD:197555 72/162 (44%)
Rab19NP_001261575.1 Rab19 19..184 CDD:133267 74/167 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.