DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX4 and Cracr2a

DIOPT Version :9

Sequence 1:NP_733043.1 Gene:RabX4 / 42960 FlyBaseID:FBgn0051118 Length:213 Species:Drosophila melanogaster
Sequence 2:XP_006506404.1 Gene:Cracr2a / 381812 MGIID:2685919 Length:751 Species:Mus musculus


Alignment Length:184 Identity:63/184 - (34%)
Similarity:112/184 - (60%) Gaps:2/184 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YKVLVLGDSNVGKTCIVHRYCDEKYYDTYISTIGIDFKQKLINLDGVPIKLQIWDTAGQERFRTL 73
            :|::.:|||.||||..:.|.|:.::.....:|:|||::.|.:.:|...:.||:||||||||:|.:
Mouse   566 FKIVFVGDSAVGKTSFLRRLCEARFSPGMAATVGIDYRVKTVTVDNAQVALQLWDTAGQERYRCI 630

  Fly    74 TTAYYRGAMGILLMYDVTNLESYNNLSYWLRNIQENASPDVVKVLAGNKCECSATQRMVDKERGE 138
            :..::|.|.|:.:|||:|..:|:.::..||.:::|.....:..:|.|||.: :..:|.|.:..||
Mouse   631 SQQFFRKADGVAVMYDLTAKQSFLSIRQWLSSVEEAVGDRIPVLLLGNKLD-NEKEREVPRGLGE 694

  Fly   139 KIAENFDMPFFEVSCKSNINIEDAFLSLARKIREQRER-RGDNFDNDESKDKKS 191
            ::|:..::.|:|.|..|..|.:::.|.|||.::||.:. |.|.........|||
Mouse   695 QLAKENNLIFYECSACSGHNAQESLLHLARLLKEQEDTVRNDTIQVGPPAKKKS 748

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX4NP_733043.1 RAB 9..170 CDD:197555 56/160 (35%)
Cracr2aXP_006506404.1 PRK12309 <32..132 CDD:183426
Smc <142..>428 CDD:224117
Rab 566..724 CDD:206640 54/158 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.