DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX4 and rab13

DIOPT Version :9

Sequence 1:NP_733043.1 Gene:RabX4 / 42960 FlyBaseID:FBgn0051118 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_958486.1 Gene:rab13 / 373105 ZFINID:ZDB-GENE-030826-30 Length:200 Species:Danio rerio


Alignment Length:196 Identity:99/196 - (50%)
Similarity:138/196 - (70%) Gaps:15/196 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALDFVATYKVLVLGDSNVGKTCIVHRYCDEKYYDTYISTIGIDFKQKLINLDGVPIKLQIWDTA 65
            ||..:...:|:|::|||.|||||::.|:.::.:..|||||||||||.|.|.::|..:|||:||||
Zfish     1 MAKKYDFLFKLLLIGDSGVGKTCLIIRFAEDNFNSTYISTIGIDFKVKTIEVEGKKVKLQVWDTA 65

  Fly    66 GQERFRTLTTAYYRGAMGILLMYDVTNLESYNNLSYWLRNIQENASPDVVKVLAGNKCECSATQR 130
            |||||:|:|||||||||||:|:||:|:.:||.|:..|:::|:||||..|.::|.||||:..| :|
Zfish    66 GQERFKTITTAYYRGAMGIILVYDITDEKSYENIQNWMKSIKENASAGVSRMLLGNKCDIEA-KR 129

  Fly   131 MVDKERGEKIAENFDMPFFEVSCKSNINIEDAFLSLARKIREQRERRGDNFDNDESKDKKSPGSN 195
            .|.||.|||:|:...:.|||.|.||:||:|::|.||||.|.              .|..|.||.:
Zfish   130 KVSKETGEKLAKEHGIRFFETSAKSSINVEESFTSLARDIL--------------LKSNKKPGPS 180

  Fly   196 G 196
            |
Zfish   181 G 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX4NP_733043.1 RAB 9..170 CDD:197555 91/160 (57%)
rab13NP_958486.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 92/180 (51%)
RAB 9..170 CDD:197555 91/161 (57%)
Effector region. /evidence=ECO:0000250 37..45 7/7 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..195 4/9 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.