DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX4 and Rab40c

DIOPT Version :9

Sequence 1:NP_733043.1 Gene:RabX4 / 42960 FlyBaseID:FBgn0051118 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_872616.1 Gene:Rab40c / 359728 RGDID:727914 Length:281 Species:Rattus norvegicus


Alignment Length:159 Identity:68/159 - (42%)
Similarity:97/159 - (61%) Gaps:2/159 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVLVLGDSNVGKTCIVHRYCDEKYYDTYISTIGIDFKQKLINLDGVPIKLQIWDTAGQERFRTLT 74
            |.|::|||:|||..|:....|......|..:.|||:|...|.|||..:||::|||:||.||.|:.
  Rat    16 KFLLVGDSDVGKGEILESLQDGAAESPYAYSNGIDYKTTTILLDGRRVKLELWDTSGQGRFCTIF 80

  Fly    75 TAYYRGAMGILLMYDVTNLESYNNLSYWLRNIQENASPDVVKVLAGNKCECSATQRMVDKERGEK 139
            .:|.|||.||||:||:||..|::.:..|::.|.|:| |.|.::|.||:... |.:|.|..|:...
  Rat    81 RSYSRGAQGILLVYDITNRWSFDGIDRWIKEIDEHA-PGVPRILVGNRLHL-AFKRQVPTEQARA 143

  Fly   140 IAENFDMPFFEVSCKSNINIEDAFLSLAR 168
            .||...|.|||||...|.|:.::|..|:|
  Rat   144 YAEKNCMTFFEVSPLCNFNVIESFTELSR 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX4NP_733043.1 RAB 9..170 CDD:197555 68/159 (43%)
Rab40cNP_872616.1 Rab40 9..281 CDD:133321 68/159 (43%)
SOCS_Rab40 187..229 CDD:239711
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.