DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX4 and CG15399

DIOPT Version :9

Sequence 1:NP_733043.1 Gene:RabX4 / 42960 FlyBaseID:FBgn0051118 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_608712.1 Gene:CG15399 / 33472 FlyBaseID:FBgn0031460 Length:242 Species:Drosophila melanogaster


Alignment Length:240 Identity:47/240 - (19%)
Similarity:79/240 - (32%) Gaps:87/240 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VATYKVLVLGDSNVGKTCI----------------------------VHRYC------------- 29
            |.|.::|:|||..||||.:                            :|.|.             
  Fly     9 VPTVRILMLGDRGVGKTSLTNLMATTEITPTPDSRTVGEESWHVQVRLHEYSKPVILPPTPTWTT 73

  Fly    30 -----DEKYYDTYIST-------IGIDFKQKLINLDGVPIKLQIWDTAGQERFRTLTTAYYRGAM 82
                 |.:.|....||       ..::|..  :|.|        |....|:|     .::|:...
  Fly    74 PSSSEDSENYPYMRSTPTTTNILYFVEFYD--LNSD--------WRMCRQQR-----ESFYKNID 123

  Fly    83 GILLMYDVTNLESYNNLSYW----LRNIQENASPDVVKVLAGNKCECSATQRMVDK------ERG 137
            ||:|:|::..|.|.::|..|    ||.|.::....:..:|..:..........:||      .|.
  Fly   124 GIVLVYNMLELSSQDSLHDWLYDPLRQICKHRHLRIRSILKNHNAPILVVGTNLDKLMRRPLRRR 188

  Fly   138 EKIAENFDMPFFEVSCKSNINIED---------AFLSLARKIREQ 173
            ..||...::....|:|....:..|         .||:...:.:||
  Fly   189 GSIAHQLNVEEMLVNCLDPQSFVDKSRNQGKLYGFLNRVIEFKEQ 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX4NP_733043.1 RAB 9..170 CDD:197555 43/232 (19%)
CG15399NP_608712.1 P-loop_NTPase 12..229 CDD:304359 43/231 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47980
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.