DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX4 and Rab40

DIOPT Version :10

Sequence 1:NP_733043.1 Gene:RabX4 / 42960 FlyBaseID:FBgn0051118 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_727611.1 Gene:Rab40 / 32195 FlyBaseID:FBgn0030391 Length:265 Species:Drosophila melanogaster


Alignment Length:178 Identity:69/178 - (38%)
Similarity:100/178 - (56%) Gaps:14/178 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALDFVATYKVLVLGDSNVGKTCIVHRYCDEKYYDTYISTIGID----------FKQKLINLDGV 55
            |..|:....|||::|||:|||..|:....|......:.|  |.|          :|...|.|:|.
  Fly     4 MTKDYDYLLKVLLVGDSDVGKHEILSNLEDPSTESPFCS--GNDCTSHILQTVAYKTTTILLEGK 66

  Fly    56 PIKLQIWDTAGQERFRTLTTAYYRGAMGILLMYDVTNLESYNNLSYWLRNIQENASPDVVKVLAG 120
            .:|||:|||:||.||.|:..:|.|||.||:|:||:||..|::.:..||:.:.|:| |.:.|||.|
  Fly    67 RVKLQLWDTSGQGRFCTIIRSYSRGAQGIILVYDITNKWSFDGIDRWLKEVDEHA-PGIPKVLVG 130

  Fly   121 NKCECSATQRMVDKERGEKIAENFDMPFFEVSCKSNINIEDAFLSLAR 168
            |:... |.:|.|..::.|..|...:|..||:|...|.||.::|..|||
  Fly   131 NRLHL-AFKRQVAAKQAETYASRNNMSCFEISPLCNFNIRESFCELAR 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX4NP_733043.1 RAB 9..170 CDD:197555 67/170 (39%)
Rab40NP_727611.1 P-loop containing Nucleoside Triphosphate Hydrolases 6..265 CDD:476819 68/176 (39%)
SOCS 192..234 CDD:470605
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.