DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX4 and Rab9D

DIOPT Version :9

Sequence 1:NP_733043.1 Gene:RabX4 / 42960 FlyBaseID:FBgn0051118 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_727432.1 Gene:Rab9D / 318149 FlyBaseID:FBgn0067052 Length:197 Species:Drosophila melanogaster


Alignment Length:168 Identity:61/168 - (36%)
Similarity:95/168 - (56%) Gaps:3/168 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YKVLVLGDSNVGKTCIVHRYCDEKYYDTYISTIGIDFKQKLINLDG--VPIKLQIWDTAGQERFR 71
            :|:::||||.|||||::.|:.|.::...:.||:|:|.::..:....  :...||:|||:..|||:
  Fly     8 FKIILLGDSGVGKTCLLMRFSDNQFTTRHRSTVGLDRRECSVEFADWRMGRMLQVWDTSDDERFK 72

  Fly    72 TLTTAYYRGAMGILLMYDVTNLESYNNLSYWLRNIQENASPDVVKVLAGNKCECSATQRMVDKER 136
            .|.....|.|.||||:||:|:.:|:.|:..|::.|:......|:.:|.|||.: ....|.|...:
  Fly    73 LLKATQCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVIVLLVGNKSD-DPNHRQVSMAQ 136

  Fly   137 GEKIAENFDMPFFEVSCKSNINIEDAFLSLARKIREQR 174
            |...|....:.|.|||.||..|:.|.|.|||..|...|
  Fly   137 GFNYAHRQSICFEEVSAKSGRNVYDIFSSLAMDIYTYR 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX4NP_733043.1 RAB 9..170 CDD:197555 59/162 (36%)
Rab9DNP_727432.1 RAB 8..171 CDD:197555 59/163 (36%)
Rab 8..167 CDD:206640 57/159 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47980
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.