DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX4 and Rab44

DIOPT Version :9

Sequence 1:NP_733043.1 Gene:RabX4 / 42960 FlyBaseID:FBgn0051118 Length:213 Species:Drosophila melanogaster
Sequence 2:XP_006256215.1 Gene:Rab44 / 309649 RGDID:1560150 Length:970 Species:Rattus norvegicus


Alignment Length:169 Identity:67/169 - (39%)
Similarity:101/169 - (59%) Gaps:1/169 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YKVLVLGDSNVGKTCIVHRYCDEKYYDTYISTIGIDFKQKLINLDGVPIKLQIWDTAGQERFRTL 73
            |.|:.|||||||||..:|....:.:.....:|:|:||:.|.:.:|.....||:||||||||:.:|
  Rat   783 YHVIFLGDSNVGKTSFLHLLHHDSFAAGLTATVGVDFRVKNLLVDNKTFALQLWDTAGQERYHSL 847

  Fly    74 TTAYYRGAMGILLMYDVTNLESYNNLSYWLRNIQENASPDVVKVLAGNKCECSATQRMVDKERGE 138
            |....|.|.|::||||||:.||:.::.|||..:|:.....|..||.|||.:|. .:|.|..|.|.
  Rat   848 TRQLLRKAEGVVLMYDVTSQESFTHVRYWLDCLQDAGVEGVAMVLLGNKTDCE-EERQVPTEAGR 911

  Fly   139 KIAENFDMPFFEVSCKSNINIEDAFLSLARKIREQRERR 177
            ::|:...:.|.|.|.....||.:..::|||.::.|.:|:
  Rat   912 RLAQELGISFGECSAALGHNILEPMMNLARSLKMQEDRQ 950

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX4NP_733043.1 RAB 9..170 CDD:197555 65/160 (41%)
Rab44XP_006256215.1 RILP-like <185..311 CDD:304877
RAB 783..944 CDD:197555 65/161 (40%)
Rab 785..941 CDD:206640 62/156 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.