DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX4 and Rasef

DIOPT Version :9

Sequence 1:NP_733043.1 Gene:RabX4 / 42960 FlyBaseID:FBgn0051118 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001264263.1 Gene:Rasef / 298138 RGDID:1306418 Length:709 Species:Rattus norvegicus


Alignment Length:208 Identity:75/208 - (36%)
Similarity:121/208 - (58%) Gaps:16/208 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YKVLVLGDSNVGKTCIVHRYCDEKYYDTYISTIGIDFKQKLINLDGVPIKLQIWDTAGQERFRTL 73
            ||:::.||:.|||:..:.|.|..::.....:|:|:||:.|.:.:||.|..||:||||||||||::
  Rat   511 YKIVLAGDAAVGKSSFLMRLCKNEFQGNTSATLGVDFQMKTLMVDGEPTVLQLWDTAGQERFRSI 575

  Fly    74 TTAYYRGAMGILLMYDVTNLESYNNLSYWLRNIQENASPDVVKVLAGNKCEC--SAT---QRMVD 133
            ..:|:|.|.|:||:||||..:|:.|:..|:..:::.....|..:|.|||.:.  :||   |:.:.
  Rat   576 AKSYFRKADGVLLLYDVTCEKSFLNVREWVAMVEDGTHRSVPIMLVGNKADLRDAATAENQKCIS 640

  Fly   134 KERGEKIAENFDMPFFEVSCKSNINIEDAFLSLARKIREQRERRGDNFDNDESKDKKSPGSNGLG 198
            ...|||:|..:...|.|.|.|...|:.:|.|.|||:::::.|       ||:||...|..:    
  Rat   641 SHLGEKLAMTYGALFCETSAKDGSNVVEAVLHLAREVKKRAE-------NDDSKSITSLAT---- 694

  Fly   199 TFSLGSLSGENRC 211
            :.|..||..:|.|
  Rat   695 STSRKSLQMKNCC 707

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX4NP_733043.1 RAB 9..170 CDD:197555 64/165 (39%)
RasefNP_001264263.1 EFh 12..72 CDD:238008
EF-hand_7 13..71 CDD:290234
RILP-like <191..268 CDD:304877
BBP1_C 192..381 CDD:291921
RAB 511..680 CDD:197555 64/168 (38%)
Rab 511..675 CDD:206640 62/163 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.