DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX4 and Rab35

DIOPT Version :9

Sequence 1:NP_733043.1 Gene:RabX4 / 42960 FlyBaseID:FBgn0051118 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001013064.1 Gene:Rab35 / 288700 RGDID:1306362 Length:201 Species:Rattus norvegicus


Alignment Length:200 Identity:78/200 - (39%)
Similarity:125/200 - (62%) Gaps:12/200 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALDFVATYKVLVLGDSNVGKTCIVHRYCDEKYYDTYISTIGIDFKQKLINLDGVPIKLQIWDTA 65
            ||.|:...:|:|::|||.|||:.::.|:.|..:..:||:|||:|||.:.:.::|..:||||||||
  Rat     1 MARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTA 65

  Fly    66 GQERFRTLTTAYYRGAMGILLMYDVTNLESYNNLSYWLRNIQENASPDVVKVLAGNKCECSATQR 130
            |||||||:|:.||||..|::::||||:.||:.|:..||..|.:|.. ||.::|.|||.: ...::
  Rat    66 GQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCD-DVCRILVGNKND-DPERK 128

  Fly   131 MVDKERGEKIAENFDMPFFEVSCKSNINIEDAFLSLARKI---------REQRERRGDNFD-NDE 185
            :|:.|...|.|....:..||.|.|.|:|:|:.|..:...:         ::|::::.|... ...
  Rat   129 VVETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKN 193

  Fly   186 SKDKK 190
            ||.||
  Rat   194 SKRKK 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX4NP_733043.1 RAB 9..170 CDD:197555 69/160 (43%)
Rab35NP_001013064.1 Rab35 3..201 CDD:133310 75/197 (38%)
Effector region. /evidence=ECO:0000250 37..45 5/7 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.