DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX4 and Rab8b

DIOPT Version :9

Sequence 1:NP_733043.1 Gene:RabX4 / 42960 FlyBaseID:FBgn0051118 Length:213 Species:Drosophila melanogaster
Sequence 2:XP_038936858.1 Gene:Rab8b / 266688 RGDID:628764 Length:208 Species:Rattus norvegicus


Alignment Length:197 Identity:101/197 - (51%)
Similarity:142/197 - (72%) Gaps:10/197 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALDFVATYKVLVLGDSNVGKTCIVHRYCDEKYYDTYISTIGIDFKQKLINLDGVPIKLQIWDTA 65
            ||..:...:|:|::|||.|||||::.|:.::.:..|:|||||||||.:.|.|||..|||||||||
  Rat     1 MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTA 65

  Fly    66 GQERFRTLTTAYYRGAM-GILLMYDVTNLESYNNLSYWLRNIQENASPDVVKVLAGNKCECSATQ 129
            |||||||:||||||||| ||:|:||:||.:|::|:..|:|||:|:||.||.:::.||||:.: .:
  Rat    66 GQERFRTITTAYYRGAMQGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMN-DK 129

  Fly   130 RMVDKERGEKIAENFDMPFFEVSCKSNINIEDAFLSLARKIREQRERRGDNFDNDESKDKKSPGS 194
            |.|.||||||:|.::.:.|.|.|.||:.|:|:||.:|||.|..:..|:        ..|..|.|:
  Rat   130 RQVSKERGEKLAIDYGIKFLETSAKSSTNVEEAFFTLARDIMTKLNRK--------MNDSNSSGA 186

  Fly   195 NG 196
            .|
  Rat   187 GG 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX4NP_733043.1 RAB 9..170 CDD:197555 93/161 (58%)
Rab8bXP_038936858.1 Rab8_Rab10_Rab13_like 6..173 CDD:206659 94/167 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.