DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX4 and RAB12

DIOPT Version :9

Sequence 1:NP_733043.1 Gene:RabX4 / 42960 FlyBaseID:FBgn0051118 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001020471.3 Gene:RAB12 / 201475 HGNCID:31332 Length:340 Species:Homo sapiens


Alignment Length:162 Identity:71/162 - (43%)
Similarity:108/162 - (66%) Gaps:2/162 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVLVLGDSNVGKTCIVHRYCDEKYYDTYISTIGIDFKQKLINLDGVPIKLQIWDTAGQERFRTLT 74
            :|:::|...||||.::.|:.|:.:.:...||:|:|||.|.:.|.|..|:||||||||||||.::|
Human   140 QVIIIGSRGVGKTSLMERFTDDTFCEACKSTVGVDFKIKTVELRGKKIRLQIWDTAGQERFNSIT 204

  Fly    75 TAYYRGAMGILLMYDVTNLESYNNLSYWLRNIQENASPDVVKVLAGNKCECSATQRMVDKERGEK 139
            :||||.|.||:|:||:|..|::::|..|::.|.:.||.|...:|.|||.:|. |.|.:.:::|||
Human   205 SAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCE-TDREITRQQGEK 268

  Fly   140 IAENF-DMPFFEVSCKSNINIEDAFLSLARKI 170
            .|:.. .|.|.|.|.|.|.|:::.||.|...|
Human   269 FAQQITGMRFCEASAKDNFNVDEIFLKLVDDI 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX4NP_733043.1 RAB 9..170 CDD:197555 70/160 (44%)
RAB12NP_001020471.3 Rab12 139..340 CDD:206699 71/162 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.