DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX4 and Rab33b

DIOPT Version :9

Sequence 1:NP_733043.1 Gene:RabX4 / 42960 FlyBaseID:FBgn0051118 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_058554.1 Gene:Rab33b / 19338 MGIID:1330805 Length:229 Species:Mus musculus


Alignment Length:172 Identity:68/172 - (39%)
Similarity:117/172 - (68%) Gaps:8/172 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YKVLVLGDSNVGKTCIVHRYCDEKYYDTYISTIGIDFKQKLINLDGVPIKLQIWDTAGQERFR-T 72
            :|::|:|||||||||:.:|:|..::.|...:|||:||:::.:::||..||:|:|||||||||| :
Mouse    34 FKIIVIGDSNVGKTCLTYRFCAGRFPDRTEATIGVDFRERAVDIDGERIKIQLWDTAGQERFRKS 98

  Fly    73 LTTAYYRGAMGILLMYDVTNLESYNNLSYWLRNIQEN-ASPDVVKVLAGNKCEC-SATQRMVDKE 135
            :...|||....::.:||:||:.|:::|..|:...::: .:.|:.::|.||||:. ||.|  |..:
Mouse    99 MVQHYYRNVHAVVFVYDMTNMASFHSLPAWIEECKQHLLANDIPRILVGNKCDLRSAIQ--VPTD 161

  Fly   136 RGEKIAENFDMPFFEVSCKS---NINIEDAFLSLARKIREQR 174
            ..:|.|:...||.||.|.|:   |.::|..|::||.|::..:
Mouse   162 LAQKFADTHSMPLFETSAKNPNDNDHVEAIFMTLAHKLKSHK 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX4NP_733043.1 RAB 9..170 CDD:197555 67/166 (40%)
Rab33bNP_058554.1 Rab33B_Rab33A 32..201 CDD:133315 68/168 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S864
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.