DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX4 and Rab10

DIOPT Version :9

Sequence 1:NP_733043.1 Gene:RabX4 / 42960 FlyBaseID:FBgn0051118 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_057885.1 Gene:Rab10 / 19325 MGIID:105066 Length:200 Species:Mus musculus


Alignment Length:204 Identity:102/204 - (50%)
Similarity:140/204 - (68%) Gaps:15/204 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YKVLVLGDSNVGKTCIVHRYCDEKYYDTYISTIGIDFKQKLINLDGVPIKLQIWDTAGQERFRTL 73
            :|:|::|||.|||||::.|:.|:.:..|:|||||||||.|.:.|.|..||||||||||||||.|:
Mouse    10 FKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQERFHTI 74

  Fly    74 TTAYYRGAMGILLMYDVTNLESYNNLSYWLRNIQENASPDVVKVLAGNKCECSATQRMVDKERGE 138
            ||:||||||||:|:||:||.:|:.|:|.|||||.|:|:.||.::|.||||:.. .:|:|.|.:||
Mouse    75 TTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMD-DKRVVPKGKGE 138

  Fly   139 KIAENFDMPFFEVSCKSNINIEDAFLSLARKIREQRERRGDNFDNDESKDKKSPGSNGLGTFSLG 203
            :||....:.|||.|.|:|||||.|||:||..|..:             ...|.|.|..:...|.|
Mouse   139 QIAREHGIRFFETSAKANINIEKAFLTLAEDILRK-------------TPVKEPNSENVDISSGG 190

  Fly   204 SLSG-ENRC 211
            .::| :::|
Mouse   191 GVTGWKSKC 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX4NP_733043.1 RAB 9..170 CDD:197555 94/160 (59%)
Rab10NP_057885.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 95/163 (58%)
Effector region. /evidence=ECO:0000250 38..46 6/7 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47980
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.