DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX4 and 4R79.2

DIOPT Version :9

Sequence 1:NP_733043.1 Gene:RabX4 / 42960 FlyBaseID:FBgn0051118 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001255966.1 Gene:4R79.2 / 181797 WormBaseID:WBGene00007067 Length:395 Species:Caenorhabditis elegans


Alignment Length:178 Identity:68/178 - (38%)
Similarity:105/178 - (58%) Gaps:13/178 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YKVLVLGDSNVGKTCIVHRYCDEKYYDTYISTIGIDFKQKLINLDGVP----IKLQIWDTAGQER 69
            :||:.:|||.|||||.:||:|..::...:.:|||:||..|.:.   :|    |.:|:||||||||
 Worm   203 FKVVFVGDSAVGKTCFLHRFCHNRFKPLFNATIGVDFTVKTMK---IPPNRAIAMQLWDTAGQER 264

  Fly    70 FRTLTTAYYRGAMGILLMYDVTNLESYNNLSYWLRNIQENASPDVVKVLAGNKCEC--SATQRMV 132
            ||::|..|:|.|.|::||:|||:.:|:.|:..|:.:::.......|..|.|||.:.  |...|..
 Worm   265 FRSITKQYFRKADGVVLMFDVTSEQSFLNVRNWIDSVRAGVDDATVMCLVGNKMDLFGSDIARSA 329

  Fly   133 DKERGEKIAENFDMPFFEVSCKSNINIEDAFLSLARKIREQRERRGDN 180
            .....||:|..|.:||||.|..:...|:    :..|::.|..:||.||
 Worm   330 VYRAAEKLAVEFKIPFFETSAYTGFGID----TCMRQMAENLQRREDN 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX4NP_733043.1 RAB 9..170 CDD:197555 63/166 (38%)
4R79.2NP_001255966.1 RAB 203..370 CDD:197555 64/173 (37%)
Rab 203..365 CDD:206640 63/168 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.