DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX4 and rsef-1

DIOPT Version :9

Sequence 1:NP_733043.1 Gene:RabX4 / 42960 FlyBaseID:FBgn0051118 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001359915.1 Gene:rsef-1 / 180593 WormBaseID:WBGene00016344 Length:634 Species:Caenorhabditis elegans


Alignment Length:164 Identity:60/164 - (36%)
Similarity:98/164 - (59%) Gaps:1/164 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TYKVLVLGDSNVGKTCIVHRYCDEKYYDTYISTIGIDFKQKLINLDGVPIKLQIWDTAGQERFRT 72
            |:::::.||:.|||:..|.|....::.:...||:|:||..|.:|:||..:.||:||||||||||:
 Worm   439 TFRIVMCGDAAVGKSSFVMRVIRRQFTNQLPSTLGVDFHVKTVNVDGRNVALQLWDTAGQERFRS 503

  Fly    73 LTTAYYRGAMGILLMYDVTNLESYNNLSYWLRNIQENASPDVVKVLAGNKCECS-ATQRMVDKER 136
            |..:|:|.|.|.:|:|||...:|:..:..|:..|:|:....:..:|.|||.:.. :|...|.|..
 Worm   504 LCKSYFRRADGAILVYDVCAEQSFLRVRDWIETIKESTERSIPIILVGNKVDMRISTPGSVAKTD 568

  Fly   137 GEKIAENFDMPFFEVSCKSNINIEDAFLSLARKI 170
            |..:|....:.|.|.|.....||::|.|:|.|::
 Worm   569 GASMAAAMGVLFMETSALDGSNIDNAMLALTREL 602

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX4NP_733043.1 RAB 9..170 CDD:197555 59/161 (37%)
rsef-1NP_001359915.1 EF-hand_7 3..63 CDD:372618
Smc <155..>362 CDD:224117
Rab 440..600 CDD:206640 58/159 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.