DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX4 and rab-19

DIOPT Version :9

Sequence 1:NP_733043.1 Gene:RabX4 / 42960 FlyBaseID:FBgn0051118 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001370091.1 Gene:rab-19 / 178301 WormBaseID:WBGene00004278 Length:210 Species:Caenorhabditis elegans


Alignment Length:197 Identity:80/197 - (40%)
Similarity:120/197 - (60%) Gaps:15/197 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YKVLVLGDSNVGKTCIVHRYCDEKYYDTYISTIGIDFKQKLINLDGVPIKLQIWDTAGQERFRTL 73
            :|::::||..|||||:|.|:.:..:.|...:|||:||..|.:.:||..:|||||||.|||||||:
 Worm    11 FKIVLVGDMGVGKTCVVQRFRNGTFVDRQGTTIGVDFTMKTLVVDGKRVKLQIWDTGGQERFRTI 75

  Fly    74 TTAYYRGAMGILLMYDVTNLESYNNLSYWLRNIQENASPDVVKVLAGNKCECSATQRMVDKERGE 138
            |.:|||.|.||:|.||:|..:|:.:|..|:.::.:.|:|:|||:|.|.||:.. .||.::.|..|
 Worm    76 TQSYYRSANGIVLCYDITCKQSFGSLQRWIDDVSKFAAPNVVKLLIGTKCDLE-DQRAIEAEEAE 139

  Fly   139 KIAE-NFDMPFFEVSCKSNINIEDAFLSLARKIREQRERRGDNFDNDESKDKKSPGSNGLGTFSL 202
            .:.. |......|.|.|.|:|:::|||.||..::.|       :|....:...|      |||.|
 Worm   140 MLQRANGMFAMLETSAKGNVNVDNAFLELATILKRQ-------YDQGVVEQGSS------GTFQL 191

  Fly   203 GS 204
            ||
 Worm   192 GS 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX4NP_733043.1 RAB 9..170 CDD:197555 71/161 (44%)
rab-19NP_001370091.1 Rab19 8..172 CDD:133267 71/161 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.