DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX4 and rab-35

DIOPT Version :9

Sequence 1:NP_733043.1 Gene:RabX4 / 42960 FlyBaseID:FBgn0051118 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_499454.1 Gene:rab-35 / 176560 WormBaseID:WBGene00004284 Length:209 Species:Caenorhabditis elegans


Alignment Length:215 Identity:86/215 - (40%)
Similarity:130/215 - (60%) Gaps:17/215 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DFVATYKVLVLGDSNVGKTCIVHRYCDEKYYDTYISTIGIDFKQKLINLDGVPIKLQIWDTAGQE 68
            |:...:|:|::|||.|||:.::.|:.|..:.:.||:|||:|||.:.::::|..:|||||||||||
 Worm     6 DYDHLFKLLIIGDSGVGKSSLLLRFADNTFSENYITTIGVDFKIRTMDINGQRVKLQIWDTAGQE 70

  Fly    69 RFRTLTTAYYRGAMGILLMYDVTNLESYNNLSYWLRNIQENASPDVVKVLAGNKCECSATQRMVD 133
            ||||:|:.||||..|::::|||||.||:.|:..||:.|:.|.. .|.|||.||||| ...:|:|.
 Worm    71 RFRTITSTYYRGTHGVVVVYDVTNGESFGNVKRWLQEIENNCD-SVQKVLVGNKCE-ENERRVVL 133

  Fly   134 KERGEKIAENFDMPFFEVSCKSNINIEDAF-----LSLARKIREQRERRGDNFDNDESKDKKSPG 193
            :......|::.::.|||.|.|.:.|:|..|     |.|..|:...:         ..|||:...|
 Worm   134 ESDARNYAQSMNISFFETSAKEDKNVEPMFTCITSLVLTAKLANPQ---------SASKDQSRTG 189

  Fly   194 SNGLGTFSLGSLSGENRCTC 213
            ...|...| ||.:.:.:|.|
 Worm   190 GVSLKDNS-GSTNQKKKCKC 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX4NP_733043.1 RAB 9..170 CDD:197555 74/165 (45%)
rab-35NP_499454.1 Rab35 5..208 CDD:133310 85/213 (40%)
RAB 11..171 CDD:197555 73/161 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.