Sequence 1: | NP_733043.1 | Gene: | RabX4 / 42960 | FlyBaseID: | FBgn0051118 | Length: | 213 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_057215.3 | Gene: | RAB10 / 10890 | HGNCID: | 9759 | Length: | 200 | Species: | Homo sapiens |
Alignment Length: | 204 | Identity: | 102/204 - (50%) |
---|---|---|---|
Similarity: | 140/204 - (68%) | Gaps: | 15/204 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 YKVLVLGDSNVGKTCIVHRYCDEKYYDTYISTIGIDFKQKLINLDGVPIKLQIWDTAGQERFRTL 73
Fly 74 TTAYYRGAMGILLMYDVTNLESYNNLSYWLRNIQENASPDVVKVLAGNKCECSATQRMVDKERGE 138
Fly 139 KIAENFDMPFFEVSCKSNINIEDAFLSLARKIREQRERRGDNFDNDESKDKKSPGSNGLGTFSLG 203
Fly 204 SLSG-ENRC 211 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RabX4 | NP_733043.1 | RAB | 9..170 | CDD:197555 | 94/160 (59%) |
RAB10 | NP_057215.3 | Rab8_Rab10_Rab13_like | 7..173 | CDD:206659 | 95/163 (58%) |
Effector region. /evidence=ECO:0000250 | 38..46 | 6/7 (86%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0078 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR47980 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.910 |