DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX4 and Rab15

DIOPT Version :9

Sequence 1:NP_733043.1 Gene:RabX4 / 42960 FlyBaseID:FBgn0051118 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_598811.3 Gene:Rab15 / 104886 MGIID:1916865 Length:212 Species:Mus musculus


Alignment Length:221 Identity:79/221 - (35%)
Similarity:133/221 - (60%) Gaps:17/221 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALDFVATYKVLVLGDSNVGKTCIVHRYCDEKYYDTYISTIGIDFKQKLINLDGVPIKLQIWDTA 65
            ||..:...:::|::|||.|||||::.|:.|.:::.::|||||:|||.|.|.:||:.:::||||||
Mouse     1 MAKQYDVLFRLLLIGDSGVGKTCLLCRFTDNEFHSSHISTIGVDFKMKTIEVDGIKVRIQIWDTA 65

  Fly    66 GQERFRTLTTAYYRGAMGILLMYDVTNLESYNNLSYWLRNIQENASPDVVKVLAGNKCECSATQR 130
            ||||::|:|..|||.|.||.|:||:::..||.::..|:.::.|.|...|.|:|.|||.: ...:|
Mouse    66 GQERYQTITKQYYRRAQGIFLVYDISSERSYQHIMKWVSDVDEYAPEGVQKILIGNKAD-EEQKR 129

  Fly   131 MVDKERGEKIAENFDMPFFEVSCKSNINIEDAFLSLARKIREQRERRGDNFDNDESKDKKSPGSN 195
            .|.:|:|:::|:.:.|.|:|.|..:|:||:::|..|...:.:...:..|..        ::..||
Mouse   130 QVGREQGQQLAKEYGMDFYETSACTNLNIKESFTRLTELVLQAHRKELDGL--------RTRASN 186

  Fly   196 GLGTFSL--------GSLSGENRCTC 213
            .|....|        |..:....|.|
Mouse   187 ELALAELEEDEGKPEGPANSSKTCWC 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX4NP_733043.1 RAB 9..170 CDD:197555 69/160 (43%)
Rab15NP_598811.3 Rab15 9..172 CDD:206698 69/163 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 192..212 3/19 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.