DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX4 and Rab28

DIOPT Version :9

Sequence 1:NP_733043.1 Gene:RabX4 / 42960 FlyBaseID:FBgn0051118 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_081571.1 Gene:Rab28 / 100972 MGIID:1917285 Length:221 Species:Mus musculus


Alignment Length:204 Identity:59/204 - (28%)
Similarity:96/204 - (47%) Gaps:19/204 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVLVLGDSNVGKTCIVHRYCDEKYYDTYISTIGIDFKQKLINLDG-VPIKLQIWDTAGQERFRTL 73
            |::||||...|||.:...:..|.:...|..|||:||..:.|.|.| :.:.||:||..||.....:
Mouse    14 KIVVLGDGTSGKTSLATCFAQETFGKQYKQTIGLDFFLRRITLPGNLNVTLQVWDIGGQTIGGKM 78

  Fly    74 TTAYYRGAMGILLMYDVTNLESYNNLSYW---LRNIQENASPDVVKVLAGNKCECSATQRMVDKE 135
            ...|..||.||||:||:||.:|:.||..|   ::.:.|.:....:..|.|||.:.. ..|.|..:
Mouse    79 LDKYIYGAQGILLVYDITNYQSFENLEDWYSVVKTVSEESETQPLVALVGNKIDLE-HMRTVKAD 142

  Fly   136 RGEKIAENFDMPFFEVSCKSNINIEDAFLSLARKI-----------REQRERRGD--NFDNDE-S 186
            :..:..:........||.|:..::...|..:|.:|           :.||..:.|  |::.:. |
Mouse   143 KHLRFCQENGFSSHFVSAKTGDSVFLCFQKVAAEILGIKLNKAEIEQSQRVVKADIVNYNQEPLS 207

  Fly   187 KDKKSPGSN 195
            :....|.|:
Mouse   208 RTVNPPRSS 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX4NP_733043.1 RAB 9..170 CDD:197555 51/163 (31%)
Rab28NP_081571.1 Rab28 13..221 CDD:206694 59/204 (29%)
RAB 13..178 CDD:197555 51/164 (31%)
Effector region. /evidence=ECO:0000250 41..49 4/7 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.