DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX4 and rab8b

DIOPT Version :9

Sequence 1:NP_733043.1 Gene:RabX4 / 42960 FlyBaseID:FBgn0051118 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001090677.1 Gene:rab8b / 100036650 XenbaseID:XB-GENE-480278 Length:207 Species:Xenopus tropicalis


Alignment Length:196 Identity:100/196 - (51%)
Similarity:143/196 - (72%) Gaps:9/196 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALDFVATYKVLVLGDSNVGKTCIVHRYCDEKYYDTYISTIGIDFKQKLINLDGVPIKLQIWDTA 65
            ||..:...:|:|::|||.|||||::.|:.::.:..|:|||||||||.:.|.|||..|||||||||
 Frog     1 MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTA 65

  Fly    66 GQERFRTLTTAYYRGAMGILLMYDVTNLESYNNLSYWLRNIQENASPDVVKVLAGNKCECSATQR 130
            |||||||:|||||||||||:|:||:||.:|::|:..|:|||:|:||.||.:::.||||:.: .:|
 Frog    66 GQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMN-DKR 129

  Fly   131 MVDKERGEKIAENFDMPFFEVSCKSNINIEDAFLSLARKIREQRERRGDNFDNDESKDKKSPGSN 195
            .|.:|:|||:|.::.:.|.|.|.||:||:|:||.:|||.|..:..|:        ..:..|||..
 Frog   130 QVSREKGEKLAIDYGIKFLETSAKSSINVEEAFFTLARDIMTKLNRK--------MNESISPGGG 186

  Fly   196 G 196
            |
 Frog   187 G 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX4NP_733043.1 RAB 9..170 CDD:197555 92/160 (58%)
rab8bNP_001090677.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 93/166 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.