DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAP3K11 and BCK1

DIOPT Version :9

Sequence 1:NP_002410.1 Gene:MAP3K11 / 4296 HGNCID:6850 Length:847 Species:Homo sapiens
Sequence 2:NP_012440.1 Gene:BCK1 / 853350 SGDID:S000003631 Length:1478 Species:Saccharomyces cerevisiae


Alignment Length:271 Identity:80/271 - (29%)
Similarity:136/271 - (50%) Gaps:32/271 - (11%)


- Green bases have known domain annotations that are detailed below.


Human   121 EVIGIGGFGKVY--RGSWRGELVAVKAAR----QDPDEDISVTAESVRQEARLFAMLAHPNIIAL 179
            |:||.|.||.||  .....||::|||...    ...:|.|..|.|::|.|......|.|.||:  
Yeast  1179 EMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDLDHLNIV-- 1241

Human   180 KAVCLEEPN--LCLVMEYAAGGPLSRALA--GRRVPPHVLVNWAVQIARGMHYLHCEALVPVIHR 240
            :.:..|..|  ..|.:||.|||.:...:.  ||...| ::.:...|:.:|:.|||.:.   ::||
Yeast  1242 QYLGFENKNNIYSLFLEYVAGGSVGSLIRMYGRFDEP-LIKHLTTQVLKGLAYLHSKG---ILHR 1302

Human   241 DLKSNNILLLQPIESDDMEHKTLKITDFGLAR---EWHKTTQMSAAGTYAWMAPEVIKAST-FSK 301
            |:|::|:||    :.|.:    .||:|||::|   :.:..:.|:..||..|||||::.... :|.
Yeast  1303 DMKADNLLL----DQDGI----CKISDFGISRKSKDIYSNSDMTMRGTVFWMAPEMVDTKQGYSA 1359

Human   302 GSDVWSFGVLLWELLTGEVPYRGIDCLAVAYGVAVNKLTLPIPSTCPEPFAQL----MADCWAQD 362
            ..|:||.|.::.|:..|:.|:..::.:|..:.:..:|...|||.......:|:    :..|:..:
Yeast  1360 KVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSKSAPPIPEDTLPLISQIGRNFLDACFEIN 1424

Human   363 PHRRPDFASIL 373
            |.:||....:|
Yeast  1425 PEKRPTANELL 1435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAP3K11NP_002410.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 11..38
SH3_MLK1-3 45..102 CDD:212992
STKc_MLK3 113..379 CDD:271049 80/271 (30%)
STYKc 117..376 CDD:214568 80/271 (30%)
Leucine-zipper 1 403..424
Leucine-zipper 2 438..459
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 537..643
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 655..847
BCK1NP_012440.1 STKc_Bck1_like 1173..1440 CDD:270799 80/271 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.