DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and HERC3

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:NP_055421.1 Gene:HERC3 / 8916 HGNCID:4876 Length:1050 Species:Homo sapiens


Alignment Length:499 Identity:121/499 - (24%)
Similarity:195/499 - (39%) Gaps:135/499 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   454 IVDVAMSDSHFVVVNEDGSAYAWGEGTHGQLGLTALEAWKHYPSRMESVRNYHVVSACAGDGFTI 518
            |:.||..:||.:.:::.|..::||.|:.|||||...|.....|..::.:....::....|:...:
Human    86 IIHVACGESHSLALSDRGQLFSWGAGSDGQLGLMTTEDSVAVPRLIQKLNQQTILQVSCGNWHCL 150

  Fly   519 LVTQAGSLLSCGSNAH--LALGQDEQRNYHSPKLIARLADVRVEQVAAGLQHVLALSREGAVYVW 581
            .:...|...:.|.|:|  |.||: |..:..||:.:..|..:.:.|||||..|..|||..|||:.|
Human   151 ALAADGQFFTWGKNSHGQLGLGK-EFPSQASPQRVRSLEGIPLAQVAAGGAHSFALSLSGAVFGW 214

  Fly   582 GTSTCGALGLGNYQQQQKFPQKILLSHVK----TKPSKIYCGPDTSAVLFANGELHVCGSNDYNK 642
            |.:..|.|||.: ::.::.|     .|||    .|...|.||.:.:|||..:|.:...|:....:
Human   215 GMNNAGQLGLSD-EKDRESP-----CHVKLLRTQKVVYISCGEEHTAVLTKSGGVFTFGAGSCGQ 273

  Fly   643 LGF-QRSAKITAFKKVQL-PHKVTQACFSSTHSV-FLVEGGYVYTMGRNAEGQRGIRHCNSVDHP 704
            ||. ..:.::...:.::| ..:|||......|:: |:...|.:|..|..|.||.|..|..:|..|
Human   274 LGHDSMNDEVNPRRVLELMGSEVTQIACGRQHTLAFVPSSGLIYAFGCGARGQLGTGHTCNVKCP 338

  Fly   705 TLV---------------DSVKSRYIVKANCS--DQCTIVASE---------------------- 730
            :.|               |..| .:|||...|  ||..::.|:                      
Human   339 SPVKGYWAAHSGQLSARADRFK-YHIVKQIFSGGDQTFVLCSKYENYSPAVDFRTMNQAHYTSLI 402

  Fly   731 -DNIITVW----------GTRNGLPGI-GSTNCGLGLQI---------CTPNME-LELGNNTAAF 773
             |..|.||          .|.||:..| .|..|..|..:         .:|.:. ::|.:....|
Human   403 NDETIAVWRQKLSEHNNANTINGVVQILSSAACWNGSFLEKKIDEHFKTSPKIPGIDLNSTRVLF 467

  Fly   774 TNFLASVYKSELILEPVDILALFSSKEQC----------------------------DRGYYVQV 810
            ...:.|  :..:|||.:     .:|.|.|                            |..||:.:
Human   468 EKLMNS--QHSMILEQI-----LNSFESCLIPQLSSSPPDVEAMRIYLILPEFPLLQDSKYYITL 525

  Fly   811 HDVYPLAHSVLVLVDTTTP------------------LISSYEG 836
              ..|||.::|.|  .|.|                  |::.|:|
Human   526 --TIPLAMAILRL--DTNPSKVLDNWWSQVCPKYFMKLVNLYKG 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855
S_TKc 105..354 CDD:214567
ATS1 445..747 CDD:227511 95/352 (27%)
HERC3NP_055421.1 RCC1 1 1..51
ATS1 2..331 CDD:227511 74/251 (29%)
RCC1 2 52..101 5/14 (36%)
RCC1 3 102..154 12/51 (24%)
RCC1 4 156..207 19/51 (37%)
RCC1 5 208..259 20/56 (36%)
RCC1 6 261..311 10/49 (20%)
RCC1 313..377 CDD:366085 19/64 (30%)
RCC1 7 313..366 15/53 (28%)
HECTc 702..1048 CDD:238033
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.