DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and AT1G69710

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:NP_177129.2 Gene:AT1G69710 / 843307 AraportID:AT1G69710 Length:1041 Species:Arabidopsis thaliana


Alignment Length:624 Identity:126/624 - (20%)
Similarity:209/624 - (33%) Gaps:183/624 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 MCEGKEYDNKSDIWALGCILGEMCCLKKTFAASNLSELVTKIMAGNY----------TPVPSGYT 329
            :|:.|:   ::::|.:|                 |..|:|::....:          ...|:.:.
plant   116 ICKDKD---EAEVWVVG-----------------LKSLITRVKVSKWKTTIKPEITSAECPTPHA 160

  Fly   330 SGLRSLMSNLLQVEAPRRPTASEVLVYWIPLIFRSLGKNKGYSYEDDV---GGPGSDQLT----- 386
            ..:...::.|.||..|...|:::.          .|||    .:.|.|   ..|.::..|     
plant   161 RRVSPFVTILDQVIQPSNETSTQT----------RLGK----VFSDIVAITAPPSNNNQTEASGN 211

  Fly   387 -----APVPA-AAYSNVSMELELPTAQTETKQLMIADTAAPHEILEKRSVLYQLKAFGTCF---- 441
                 :|.|| ...||:......|...:.:..:..:...:.||         ...|.|..|    
plant   212 LFCPFSPTPANVENSNLRFSTNDPFRLSLSSAVSTSSHGSYHE---------DFDALGDVFVWGE 267

  Fly   442 ---------------SMAPIQLPPKA----VIVD---VAMSDSHFVVVNEDGSAYAWGEGTHGQL 484
                           |.....|.|||    :::|   :|....|.|:|.:.|..::||||..|:|
plant   268 SISDGVLSGTGNSLNSTTEDALLPKALESTIVLDAQNIACGKCHAVLVTKQGEIFSWGEGKGGKL 332

  Fly   485 GLTALEAWKHYPSRMESVRNYHVVSACAGDGFTILVTQAGSLLSCGSNAHL-------------- 535
            | ..||.....|..:.|||.....|...||..|..:||:|.|.|.|...|.              
plant   333 G-HGLETDAQKPKFISSVRGLGFKSLACGDFHTCAITQSGDLYSWGDGTHNVDLLGHGNESSCWI 396

  Fly   536 -----------------------------------------ALGQDEQRNYHSPKLIARLADVRV 559
                                                     |||..::|:...|:.:..|..:.|
plant   397 PKRVTGDLQGLYVSDVACGPWHTAVVASSGQLFTFGDGTFGALGHGDRRSTSVPREVESLIGLIV 461

  Fly   560 EQVAAGLQHVLAL-------------SREGAVYVWGTSTCGALGLGNYQQQQKFPQKILLSHVKT 611
            .:||.|:.|..|:             |..|.|:.||....|.||.|:  ...|...:.::|....
plant   462 TKVACGVWHTAAVVEVTNEASEAEVDSSRGQVFTWGDGEKGQLGHGD--NDTKLLPECVISLTNE 524

  Fly   612 KPSKIYCGPDTSAVLFANGELHVCGSNDYNKLGFQRSAKITAFKKVQ---LPHKVTQACFSSTHS 673
            ...::.||...:....:.|.::..||..|.:|| ..:||....::|:   :...|.:....|.|.
plant   525 NICQVACGHSLTVSRTSRGHVYTMGSTAYGQLG-NPTAKGNFPERVEGDIVEASVEEIACGSYHV 588

  Fly   674 VFLVEGGYVYTMGRNAEGQRGIRHCNSVDHPTLVDSVKSRYIVKANCSDQCTIV--------ASE 730
            ..|.....:||.|:...||.|..:..:...|.:|..::.:.:....|....|.|        .||
plant   589 AVLTSKSEIYTWGKGLNGQLGHGNVENKREPAVVGFLREKQVKAITCGSNFTAVICVHKWVPGSE 653

  Fly   731 DNIITVWGTRNGL----PGIGSTNCGLGL-QICTPNMEL 764
            .::..  |.||..    ......||||.. ::|:....|
plant   654 HSLCA--GCRNPFNFRRKRHNCYNCGLVFCKVCSSRKSL 690

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855 13/93 (14%)
S_TKc 105..354 CDD:214567 13/88 (15%)
ATS1 445..747 CDD:227511 88/391 (23%)
AT1G69710NP_177129.2 PH_PLC_plant-like 25..135 CDD:270171 6/38 (16%)
RCC1_2 354..381 CDD:290274 10/26 (38%)
RCC1 370..422 CDD:278826 5/51 (10%)
RCC1 425..474 CDD:278826 11/48 (23%)
RCC1 491..537 CDD:278826 12/47 (26%)
RCC1 543..591 CDD:278826 12/48 (25%)
RCC1 596..643 CDD:278826 10/46 (22%)
FYVE 646..714 CDD:214499 11/47 (23%)
DUF4200 838..936 CDD:290574
BRX_N 896..>921 CDD:290432
BRX 981..1035 CDD:285568
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.