DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and NEK1

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:NP_001185224.1 Gene:NEK1 / 841893 AraportID:AT1G54510 Length:612 Species:Arabidopsis thaliana


Alignment Length:254 Identity:93/254 - (36%)
Similarity:151/254 - (59%) Gaps:2/254 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 LANYEKVRVVGQGSFGIAILYRRKSDGHQIVFKQINLSELSPPGRDLAMNEVDVFSKLHHPNIVS 166
            :..||.:..:|:||||.|:|.|.|.:..:.|.|:|.|:..:...|..|..|:::.||:.||.||.
plant     1 MEQYEFLEQIGKGSFGSALLVRHKHEKKKYVLKKIRLARQTQRTRRSAHQEMELISKMRHPFIVE 65

  Fly   167 YLGSFI-KDNTLLIEMEYADGGTLAQIIAERQGKLHFPERYIIAVFEQISSAINYMHSENILHRD 230
            |..|:: |...:.|.:.|.:||.:||.|.:..| :||.|..:.....|:...:.|:||.:|||||
plant    66 YKDSWVEKACYVCIVIGYCEGGDMAQAIKKSNG-VHFQEEKLCKWLVQLLMGLEYLHSNHILHRD 129

  Fly   231 LKTANVFLNRRGIVKIGDFGISKIMNTKIHAQTVLGTPYYFSPEMCEGKEYDNKSDIWALGCILG 295
            :|.:|:||.:...:::||||::||:.:.....:|:|||.|..||:.....|.:|||||:|||.:.
plant   130 VKCSNIFLTKEQDIRLGDFGLAKILTSDDLTSSVVGTPSYMCPELLADIPYGSKSDIWSLGCCIY 194

  Fly   296 EMCCLKKTFAASNLSELVTKIMAGNYTPVPSGYTSGLRSLMSNLLQVEAPRRPTASEVL 354
            ||..||..|.|.::..|:.||.....:|:|:.|:...|.|:.::|:.....||:||::|
plant   195 EMAYLKPAFKAFDMQALINKINKTIVSPLPAKYSGPFRGLVKSMLRKNPEVRPSASDLL 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855 93/252 (37%)
S_TKc 105..354 CDD:214567 92/249 (37%)
ATS1 445..747 CDD:227511
NEK1NP_001185224.1 STKc_Nek 3..258 CDD:270855 93/252 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 177 1.000 Domainoid score I1076
eggNOG 1 0.900 - - E1_KOG0589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000168
OrthoInspector 1 1.000 - - mtm947
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X891
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.