DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and UVR8

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:NP_201191.1 Gene:UVR8 / 836506 AraportID:AT5G63860 Length:440 Species:Arabidopsis thaliana


Alignment Length:396 Identity:100/396 - (25%)
Similarity:165/396 - (41%) Gaps:65/396 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   382 SDQLTAP------VPAAAYSNVSM---ELELPTAQTETKQLMIADTAAPHEILEKRSVLYQLKAF 437
            :|::|||      :.|.|..:|::   ::.....:.|..||       .|...|.|....||.|.
plant     7 ADEVTAPPRKVLIISAGASHSVALLSGDIVCSWGRGEDGQL-------GHGDAEDRPSPTQLSAL 64

  Fly   438 GTCFSMAPIQLPPKAVIVDVAMSDSHFVVVNEDG-SAYAWGEGTHGQLGLTALEAWKH------- 494
                        ....||.|.....|.|..::.| ..|:||.|..|:||        |       
plant    65 ------------DGHQIVSVTCGADHTVAYSQSGMEVYSWGWGDFGRLG--------HGNSSDLF 109

  Fly   495 YPSRMESVRNYHVVSACAGDGFTILVTQAGSLLSCGSNAHLALGQDEQRNYHSPKLIARLADVRV 559
            .|..::::....:.....||...:.||..|.:.|.|.|.:..||..:..:...|:.|.....:|:
plant   110 TPLPIKALHGIRIKQIACGDSHCLAVTMEGEVQSWGRNQNGQLGLGDTEDSLVPQKIQAFEGIRI 174

  Fly   560 EQVAAGLQHVLALSREGAVYVWGTSTCGALGLGNYQQQQKFPQKILLSHVKTKPSKIYCGPDTSA 624
            :.||||.:|..|::.:|.:|.||....|.||||: :..:..|::: .|....|.|.:.||...:.
plant   175 KMVAAGAEHTAAVTEDGDLYGWGWGRYGNLGLGD-RTDRLVPERV-TSTGGEKMSMVACGWRHTI 237

  Fly   625 VLFANGELHVCGSNDYNKLGFQRSAKITAFKKVQLPHK--------VTQACFSSTHSVFLVEGGY 681
            .:..:|.|:..|.:.|.:||.      ...:...:|||        ::|......|::.|...|.
plant   238 SVSYSGALYTYGWSKYGQLGH------GDLEDHLIPHKLEALSNSFISQISGGWRHTMALTSDGK 296

  Fly   682 VYTMGRNAEGQRGIRHCNSVDH--PTLVDSVKSRYIVKANCSDQCTIVASEDNIITVWGT-RNGL 743
            :|..|.|..||.|:.  |::|.  |..|.....:.:|:.:|..:.|:..:|.|.:..||. .||.
plant   297 LYGWGWNKFGQVGVG--NNLDQCSPVQVRFPDDQKVVQVSCGWRHTLAVTERNNVFAWGRGTNGQ 359

  Fly   744 PGIGST 749
            .|||.:
plant   360 LGIGES 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855
S_TKc 105..354 CDD:214567
ATS1 445..747 CDD:227511 82/320 (26%)
UVR8NP_201191.1 RCC1_2 20..46 CDD:404432 4/25 (16%)
ATS1 36..363 CDD:227511 91/363 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.