DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and RUG3

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:NP_974971.2 Gene:RUG3 / 836208 AraportID:AT5G60870 Length:452 Species:Arabidopsis thaliana


Alignment Length:270 Identity:76/270 - (28%)
Similarity:114/270 - (42%) Gaps:52/270 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   447 QLPPKAV-------IVDVAMSDSHFVVVNEDGSAYAWG-EGTHGQLGL---------TALEAWKH 494
            :|.|:.|       |..:|.|.:|...:.|.|..|.|| |...|:|||         ..|..   
plant   192 ELVPRRVDDSWDCKISAIATSGTHTAAITESGELYMWGREEGDGRLGLGPGRGPNEGGGLSV--- 253

  Fly   495 YPSRMESVRNYHVVSACAGDGFTILVTQAGSLLSCGSNAHLALGQDEQRNYHSPKLIARLADVRV 559
             ||::::: ...|.|...|..||:.:|:.|.|.:.|:|::..||:.:......|..:..|..||:
plant   254 -PSKVKAL-TVPVASVSCGGFFTMALTKEGQLWNWGANSNYELGRGDNLGGWEPMPVPSLEGVRI 316

  Fly   560 EQVAAGLQHVLALSREGAVYVWGTSTCGALGLGNYQQQQKFPQKILLSHVKTKPSKIYCGPDTSA 624
            .|:|.|..|.|||:.||.|..||....|.||..:. :.||.|.:|.....| |...|..|..:||
plant   317 TQIACGGYHSLALTEEGKVLSWGHGGHGQLGSSSL-RNQKVPTEIEALADK-KIVFIASGGSSSA 379

  Fly   625 V-------LFANGELHVCGSNDYNKLGFQRSAKITAFKKVQL---------------PHKVTQAC 667
            .       |...|||.:.|:....:||      :....::|.               ||||....
plant   380 AITGWDWFLTDGGELWMWGNAKDFQLG------VPGLPEIQTTPVEVNFLTEEDECQPHKVISIS 438

  Fly   668 FSSTHSVFLV 677
            ..::|::.||
plant   439 IGASHALCLV 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855
S_TKc 105..354 CDD:214567
ATS1 445..747 CDD:227511 76/270 (28%)
RUG3NP_974971.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.