DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and RUG2

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:NP_199644.2 Gene:RUG2 / 834886 AraportID:AT5G48330 Length:455 Species:Arabidopsis thaliana


Alignment Length:395 Identity:95/395 - (24%)
Similarity:147/395 - (37%) Gaps:82/395 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   426 EKRSVLY----QLKAFGTCFSMAP------------IQLPPKAVIVDVAMSDSHFVVVNEDGSAY 474
            |:|:|:.    .|.|.|...|..|            ..||  :.|..::....|.:.|...|..:
plant    42 ERRTVMSFGDGNLGALGLSSSSIPGMGMDAYEPTVVSNLP--SDISSISAGHYHSLAVTSSGEIW 104

  Fly   475 AWGEGTHGQLGLTALEA---WKHYPSRMESVRNYHVVSACAGDGFTILVTQAGSLLSCG--SNAH 534
            |||....||||...:::   .:..|.|:|.:.|.:|.:|.|....:..:...|||...|  ....
plant   105 AWGRNDEGQLGRIVIDSSRDSRSEPKRVEGLENVNVQAAFASGVVSAAIGDDGSLWVWGRSKRGQ 169

  Fly   535 LALGQD--EQRNYHSPKLIARLADVRVEQVAAGLQHVLALSREGAVYVWGTSTCGALG-LG---- 592
            |.||..  |.|   .|..:..||...|.:|:.|..|.|||:.:|.|:.||....|.:| :|    
plant   170 LGLGNGIIEAR---VPSRVENLAAEHVVKVSLGWGHALALTVDGKVFGWGYVADGRVGNVGLPLE 231

  Fly   593 ---------------------NYQQQQKFPQKILLSHVK------------------TKPSKIYC 618
                                 |.:..:|   |::.:..|                  .|.:.|.|
plant   232 ASLLDSITDGSMKGHHAAGDLNLEAAEK---KVVEAMSKENDMPIAWEPCLVEETCNEKVADIAC 293

  Fly   619 GPDTSAVLFANGELHVCGSNDYNKLGFQRSAKITAFKKVQLPHKVTQACFSSTHSVFLVEGG--Y 681
            |.|.|.:|..:|.|...|||.|.:||  ||.:....|.|.:............||:.:...|  .
plant   294 GSDHSLILCHDGTLLSAGSNIYGQLG--RSKQDLGMKPVDITESPISIAAGLGHSLAICNRGERN 356

  Fly   682 VYTMGRNAEGQRGIRHCNSVDHPTLVDSVKSRYIVKANCSDQCTIVASEDNIITVWGT-RNGLPG 745
            :.:.|.|...|.|.....::  |..|:..........:.....::..:|.....|||. :||..|
plant   357 ILSWGWNRSRQLGRGKPENL--PREVEGFDGESPASVSAGRVHSLCVTEKGEAWVWGCGKNGRLG 419

  Fly   746 IGSTN 750
            :||::
plant   420 LGSSS 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855
S_TKc 105..354 CDD:214567
ATS1 445..747 CDD:227511 86/367 (23%)
RUG2NP_199644.2 ATS1 36..432 CDD:227511 95/395 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.