DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and AT5G42140

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:NP_001318728.1 Gene:AT5G42140 / 834219 AraportID:AT5G42140 Length:1078 Species:Arabidopsis thaliana


Alignment Length:746 Identity:159/746 - (21%)
Similarity:243/746 - (32%) Gaps:247/746 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 YRRKSDGHQIVF------KQINLSELSP--PGRDLAMNEVDVFSKLHHPNIVSYLG-SFIKDN-- 175
            :|..:|...:::      |::.|:.:|.  ||:..|     ||.:...|: ..||. |.|..|  
plant    41 FRLSNDETSLIWISNGGEKRLKLATVSKIVPGQRTA-----VFQRYLRPD-KDYLSFSLIYSNRK 99

  Fly   176 -TL------LIEME---------------------YADGGTLAQIIAERQGKLHFPERYIIAVFE 212
             ||      .:|.|                     ::|||  ..|...|...|..|....:....
plant   100 RTLDLICKDKVEAEVWIAGLKALISGQAGRSKIDGWSDGG--LSIADSRDLTLSSPTNSSVCASR 162

  Fly   213 QISSAINYMHSENILHRDLKTANVFLNRRGIVKIGD--------------FGISKIMNTKIHAQT 263
            ..:.|.:..:|.| ..|..:|.|...:.|..|....              ..:|.:.::..|.. 
plant   163 DFNIADSPYNSTN-FPRTSRTENSVSSERSHVASDSPNMLVRGTGSDAFRVSVSSVQSSSSHGS- 225

  Fly   264 VLGTPYYFSPEMCE--GKEYDNKSDIWALGCILGEMCCLKKTFAASNLSELVTKIMAGNYTPVPS 326
                    :|:.|:  |..|     ||      ||:.|           |.|||..|        
plant   226 --------APDDCDALGDVY-----IW------GEVLC-----------ENVTKFGA-------- 252

  Fly   327 GYTSGLRSLMSNLLQVEAPRRPTASEVLVYWIPLIFRSLGKNKGYSYEDDVGGPGSDQLTAPVPA 391
                                                   .||.||.      |..||.|   :|.
plant   253 ---------------------------------------DKNIGYL------GSRSDVL---IPK 269

  Fly   392 AAYSNVSMELE----------LPTAQTET-----------KQLMIADTAAPHEILEKRSVLYQLK 435
            ...|||.:::.          |.:.|.|.           ...|..|...| :::|         
plant   270 PLESNVVLDVHHIACGVKHAALVSRQGEVFTWGEASGGRLGHGMGKDVTGP-QLIE--------- 324

  Fly   436 AFGTCFSMAPIQLPPKAVIVD-VAMSDSHFVVVNEDGSAYAWGEGTH--GQLGL-TALEAWKHYP 496
                  |:|       |..:| ||..:.|...|...|..|.||:|||  |.||. |.:..|  .|
plant   325 ------SLA-------ATSIDFVACGEFHTCAVTMTGEIYTWGDGTHNAGLLGHGTDVSHW--IP 374

  Fly   497 SRMES-VRNYHVVSACAGDGFTILVTQAGSLLSCGSNAHLALGQDEQRNYHSPKLIARLADVRVE 560
            .|:.. :....:.|...|...|.|:|..|.|.:.|......||..::.....|:.:..|:.:|..
plant   375 KRISGPLEGLQIASVSCGPWHTALITSTGQLFTFGDGTFGVLGHGDKETVFYPREVESLSGLRTI 439

  Fly   561 QVAAGLQHVLALSR-----------EGAVYVWGTSTCGALGLGNYQQQQKFPQKI--LLSHVKTK 612
            .||.|:.|..|:..           .|.::.||......||.|:.:.:.| |..:  |:.|..  
plant   440 AVACGVWHAAAIVEVIVTHSSSSVSSGKLFTWGDGDKSRLGHGDKEPRLK-PTCVSALIDHTF-- 501

  Fly   613 PSKIYCGPDTSAVLFANGELHVCGSNDYNKLGFQRS-AKITAFKKVQLPHKVTQACF-----SST 671
             .::.||...:..|..:|:::..||..|.:||...: .|:...    :..|:|:.|.     .:.
plant   502 -HRVACGHSLTVGLTTSGKVYTMGSTVYGQLGNPNADGKLPCL----VEDKLTKDCVEEIACGAY 561

  Fly   672 HSVFLVEGGYVYTMGRNAEGQRGIRHCNSVDHPTLVDSVKSRYIVKANCSDQCTIVASEDNIITV 736
            |...|.....|:|.|:.|.|:.|.........|||||::|.|::....|....|...    .:..
plant   562 HVAVLTSRNEVFTWGKGANGRLGHGDVEDRKAPTLVDALKERHVKNIACGSNFTAAI----CLHK 622

  Fly   737 W--GTRNG-----LPGIGST-------NCGL 753
            |  ||...     ....|.|       ||||
plant   623 WVSGTEQSQCSACRQAFGFTRKRHNCYNCGL 653

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855 51/291 (18%)
S_TKc 105..354 CDD:214567 51/286 (18%)
ATS1 445..747 CDD:227511 81/332 (24%)
AT5G42140NP_001318728.1 PH_PLC_plant-like 12..124 CDD:270171 20/88 (23%)
ATS1 <282..614 CDD:227511 86/364 (24%)
FYVE 621..689 CDD:214499 9/33 (27%)
BRX_N 869..904 CDD:372684
BRX 1003..1057 CDD:369842
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.