DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and AT5G16040

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:NP_197108.1 Gene:AT5G16040 / 831461 AraportID:AT5G16040 Length:396 Species:Arabidopsis thaliana


Alignment Length:307 Identity:74/307 - (24%)
Similarity:119/307 - (38%) Gaps:88/307 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   454 IVDVAMSDSHFVVVNEDGSAYAWGEGTHGQLG-------------------------LTALEA-- 491
            ||..|:...|.:.|::.|.|||||...:||.|                         ||..:.  
plant    93 IVQAAIGGWHCLAVDDQGRAYAWGGNEYGQCGEEPSKDETGRPVRRDIVIPKRCAQQLTVRQVAA 157

  Fly   492 --------------------WK-------HYPSRMESVRNYHVVSACAGDGFTILVTQAGSLLSC 529
                                |.       ..|.|::.:.|..:::  .|....:.:.:.|:|.:.
plant   158 GGTHSVVLTREGYVWTWGQPWPPGDIKQISVPVRVQGLENVRLIA--VGAFHNLALKEDGTLWAW 220

  Fly   530 GSNAH--LALGQDEQRNYHSPKLIARLADVRVEQVAAGLQHVLALSREGAVYVWGTSTCGALGLG 592
            |:|.:  |..|..:.|:|..|  :..|.|:.:..:|||..|..||:.||.||.||....|.||.|
plant   221 GNNEYGQLGTGDTQPRSYPIP--VQGLDDLTLVDIAAGGWHSTALTNEGEVYGWGRGEHGRLGFG 283

  Fly   593 NYQQQQK-FPQKI-LLSHVKTKPSKIYCGPDTSAVLFANGELHVCGSNDYNKLGFQRSAKITAFK 655
            :..:..| .|||: ||:....  .::.||...|..|..:|.:...|..|:.:||:.|  |:|..:
plant   284 DNDKSSKMLPQKVNLLAGEDI--IQVSCGGTHSVALTRDGRIFSFGRGDHGRLGYGR--KVTTGQ 344

  Fly   656 KVQLPHKVTQ---------------------ACFSSTHSVFLVEGGY 681
            .::||..:..                     || ...|::.:||..|
plant   345 PLELPIHIPPPEGRFNHTDEEDDGKWIAKHVAC-GGRHTLAIVEWKY 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855
S_TKc 105..354 CDD:214567
ATS1 445..747 CDD:227511 74/307 (24%)
AT5G16040NP_197108.1 ATS1 6..339 CDD:227511 64/253 (25%)
RCC1 320..385 CDD:395335 13/67 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.