DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and NEK4

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:NP_001326588.1 Gene:NEK4 / 825503 AraportID:AT3G63280 Length:609 Species:Arabidopsis thaliana


Alignment Length:385 Identity:116/385 - (30%)
Similarity:187/385 - (48%) Gaps:60/385 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 ELANYEKVRVVGQGSFGIAILYRRKSDGHQIVFKQINLSELSPPGRDLAMNEVDVFSKLHHPNIV 165
            ::..||.:..:|:||||.|:|.|.|.:..:.|.|:|.|:..|...|..|..|:::.|.:.:|.:|
plant    54 QMERYEVLEQIGKGSFGSALLVRHKQERKKYVLKKIRLARQSDRARRSAHQEMELISTVRNPFVV 118

  Fly   166 SYLGSFI-KDNTLLIEMEYADGGTLAQIIAERQGKLHFPERYIIAVFEQISSAINYMHSENILHR 229
            .|..|:: |...:.|.:.|..||.:...|....| :||||..:.....|:..|::|:||.:||||
plant   119 EYKDSWVEKGCYVCIVIGYCQGGDMTDTIKRACG-VHFPEEKLCQWLVQLLMALDYLHSNHILHR 182

  Fly   230 DLKTANVFLNRRGIVKIGDFGISKIMNTKIHAQTVLGTPYYFSPEMCEGKEYDNKSDIWALGCIL 294
            |:|.:|:||.:...:::||||::||:.:.....:|:|||.|..||:.....|.:|||||:|||.:
plant   183 DVKCSNIFLTKEQDIRLGDFGLAKILTSDDLTSSVVGTPSYMCPELLADIPYGSKSDIWSLGCCM 247

  Fly   295 GEMCCLKKTFAASNLSELVTKIMAGNYTPVPSGYTSGLRSLMSNLLQVEAPRRPTASEVL----- 354
            .||...|..|.||::..|:|||......|:|:.|:...|.|:.::|:.....||:|:|:|     
plant   248 YEMAAHKPPFKASDVQTLITKIHKLIMDPIPAMYSGSFRGLIKSMLRKNPELRPSANELLNHPHL 312

  Fly   355 ------VYW---------IPLIF----RSLGKNKGYSYEDD-----------VGGPGSDQLTAPV 389
                  ||.         .||.|    .:|.:.:..|:.:|           .|...|....:|.
plant   313 QPYISMVYMKLESPRRSTFPLQFSERDATLKERRRSSFSNDRRLNPSVSDTEAGSVSSSGKASPT 377

  Fly   390 PAAAYSNVS-------MELELPTAQTETKQL-------MIADTAA---------PHEILE 426
            |......||       .|..:|..|.|.|:.       .:|.|:|         .||:::
plant   378 PMFNGRKVSEVTVGVVREEIVPQRQEEAKKQSGAARTPRVAGTSAKASTQRTVFKHELMK 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855 94/275 (34%)
S_TKc 105..354 CDD:214567 91/249 (37%)
ATS1 445..747 CDD:227511
NEK4NP_001326588.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 177 1.000 Domainoid score I1076
eggNOG 1 0.900 - - E1_KOG0589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000168
OrthoInspector 1 1.000 - - mtm947
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X891
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.