DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and AT3G53830

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:NP_001327553.1 Gene:AT3G53830 / 824550 AraportID:AT3G53830 Length:500 Species:Arabidopsis thaliana


Alignment Length:395 Identity:92/395 - (23%)
Similarity:142/395 - (35%) Gaps:114/395 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   445 PIQLPPKAVIVDVAMSDSHFVVVNEDGSAYAWGEGTHGQLGLTALEAWKHYPSRMESVRNYHVVS 509
            |..||.:|.:|..:...:|..||.|.|.|:.||              ||......:.|......|
plant    98 PFPLPTEAPVVQASSGWAHCAVVTETGEAFTWG--------------WKECIPSKDPVGKQQSGS 148

  Fly   510 ACAGD--------------------GFTILVTQAGSLLSCGSNA--------------------- 533
            :..||                    .|:|::.   |..|.||||                     
plant   149 SEQGDIGWDIFGCSVVIFLLLMDMVTFSIVIV---SPASQGSNAASGTTLQNENQKVGEESVKRR 210

  Fly   534 HLALGQDEQRNYHS--------PKLIARLADVRVEQVAAGLQHVLALSREGAVYVWGTSTCGALG 590
            .::..:||...:.|        |.|::....||:..||.|.:|.||||..|.::.||....|.||
plant   211 RVSTAKDETEGHTSGGDFFATTPSLVSVGLGVRITSVATGGRHTLALSDLGQIWGWGYGGEGQLG 275

  Fly   591 LGNYQQQQKFP-------------QKILLSH----------VKTKPSK----IYCGPDTSAVLFA 628
            ||:..:....|             ::..:.|          ...:|.:    |.||...||.:..
plant   276 LGSRIKMVSSPHLIPCLESIGSGKERSFILHQGGTTTTSAQASREPGQYIKAISCGGRHSAAITD 340

  Fly   629 NGELHVCGSNDYNKLGF------QRSAKITAFKKVQLPHKVTQACFSSTHSVFLVEGGYVYTMGR 687
            .|.|...|...|.:.|.      .|...::..|.|:: ..|....:   |::.:...|.||..|.
plant   341 AGGLITFGWGLYGQCGHGNTNDQLRPMAVSEVKSVRM-ESVAAGLW---HTICISSDGKVYAFGG 401

  Fly   688 NAEGQRGIRHCNSVDH----PTLVD--SVKSRYIVKANCSDQCTIVASEDNIITVWG-TRNGLPG 745
            |..||.|    ...||    |.|:|  :::.::....:|..:.:.|.:||..:..|| .:.|..|
plant   402 NQFGQLG----TGTDHAEILPRLLDGQNLEGKHAKAVSCGARHSAVLAEDGQLLCWGWNKYGQLG 462

  Fly   746 IGSTN 750
            :|.||
plant   463 LGDTN 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855
S_TKc 105..354 CDD:214567
ATS1 445..747 CDD:227511 89/390 (23%)
AT3G53830NP_001327553.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.